Protein Info for LRK53_RS11175 in Rhodanobacter sp000427505 FW510-R12

Annotation: outer membrane protein assembly factor BamB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR03300: outer membrane assembly lipoprotein YfgL" amino acids 10 to 398 (389 residues), 389.3 bits, see alignment E=7.3e-121 PF13360: PQQ_2" amino acids 49 to 100 (52 residues), 28.4 bits, see alignment 2e-10 amino acids 118 to 327 (210 residues), 167.9 bits, see alignment E=4.6e-53 amino acids 311 to 397 (87 residues), 38.3 bits, see alignment E=1.9e-13 PF01011: PQQ" amino acids 53 to 149 (97 residues), 37 bits, see alignment E=2.7e-13

Best Hits

KEGG orthology group: None (inferred from 40% identity to sml:Smlt2059)

Predicted SEED Role

"Outer membrane protein YfgL, lipoprotein component of the protein assembly complex (forms a complex with YaeT, YfiO, and NlpB)"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (403 amino acids)

>LRK53_RS11175 outer membrane protein assembly factor BamB (Rhodanobacter sp000427505 FW510-R12)
MKPEMIKRALLITLASLVTLTGCHSFKKENVQPPTPLAKDFKPTVQVTRLWRSSVGDGAG
TSGVRLRPTVVDGVLYAASTDGKLVALDAASGKSLWSKSSRTHGWFGWGDKKRKDATYAG
GPAVSGDLLAVGTLDGHVYAVNAKDGSPRWDVAVSSQVLASPVIVGDMVVVRTGDGRIYA
LDAATSQRRWVYDQGTVPLLSLRGNGPLLAANGVLFFGSDDGKLVALRQDNGAKLWEQKL
ASGEGRTEIDRLNDADGAILLDGSTLYGTAYHGNLVAVDGPSGRPLWTHPFSSFESPAVN
DHAVYGVNDASVVWAFDKNGGADMWKNDALKYRWLTGPAVQGNYVVVGDLEGYVHWLQTG
DGALAARERLSKKAIRAQPLVVGDTVYVEDVEGRIGAYRLSAH