Protein Info for LRK53_RS11160 in Rhodanobacter sp000427505 FW510-R12

Annotation: IMP dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 485 PF00478: IMPDH" amino acids 7 to 470 (464 residues), 532.7 bits, see alignment E=9.4e-164 TIGR01302: inosine-5'-monophosphate dehydrogenase" amino acids 7 to 451 (445 residues), 624.3 bits, see alignment E=6.3e-192 PF00571: CBS" amino acids 93 to 138 (46 residues), 45.5 bits, see alignment 1.9e-15 amino acids 147 to 202 (56 residues), 35.7 bits, see alignment 2.3e-12 PF03060: NMO" amino acids 207 to 369 (163 residues), 36.3 bits, see alignment E=1.1e-12 PF01070: FMN_dh" amino acids 259 to 361 (103 residues), 34.6 bits, see alignment E=2.7e-12 PF01645: Glu_synthase" amino acids 288 to 359 (72 residues), 21.5 bits, see alignment E=3e-08

Best Hits

Swiss-Prot: 67% identical to IMDH_ACICA: Inosine-5'-monophosphate dehydrogenase (guaB) from Acinetobacter calcoaceticus

KEGG orthology group: K00088, IMP dehydrogenase [EC: 1.1.1.205] (inferred from 77% identity to xal:XALc_1580)

MetaCyc: 61% identical to inosine 5'-monophosphate dehydrogenase (Escherichia coli K-12 substr. MG1655)
IMP dehydrogenase. [EC: 1.1.1.205]

Predicted SEED Role

"Inosine-5'-monophosphate dehydrogenase (EC 1.1.1.205)" in subsystem Purine conversions (EC 1.1.1.205)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.205

Use Curated BLAST to search for 1.1.1.205

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (485 amino acids)

>LRK53_RS11160 IMP dehydrogenase (Rhodanobacter sp000427505 FW510-R12)
MRILAEALTYDDVYLVPGHSVVLPRDVDTSTRFTRNLRLNIPIVSAAMDTVTEARLAITM
AQQGGIGIIHKNMTAEQQAAEVRLVKKFEAGVIRSPITVGPDTSIREVLRLTHAHNISGV
PVVEGSKLVGIVTSRDMRFERKPEDPVRNIMTRQDKLVTVKEGASQDEVLQLLHRHRIEK
VLVVNDAFQLRGLITVKDIQKARDNPYAAKDSHEALLVGAAVGVGGDTEQRVAALVDAGV
DVLVVDTAHGHSQGVIERAGWVKKHYPQVQVIAGNIVTGEAARALLDVGVDAVKVGVGPG
SICTTRVVAGVGVPQITAIDLVASALKDEIPLIADGGIRYSGDIPKALAAGASSVMLGSM
FAGTEESPGEVELFQGRSYKSYRGMGSIGAMQLGSKDRYFQDEADADKLVPEGIEGRVPY
RGPLRNIIHQLIGGLRASMGYLGAATVDDVRHKAQFVKVTSAGVTEAHPHDIQITKEAPN
YRLNS