Protein Info for LRK53_RS11155 in Rhodanobacter sp000427505 FW510-R12

Annotation: glutamine-hydrolyzing GMP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00888: GMP synthase (glutamine-hydrolyzing), N-terminal domain
  • amino acids 9 to 200 (192 residues), 246.5 bits, E=1.3e-77
• PF00117: GATase
  • amino acids 10 to 195 (186 residues), 148.6 bits, E=5.2e-47
• PF07722: Peptidase_C26
  • amino acids 73 to 179 (107 residues), 33.8 bits, E=9.6e-12
• TIGR00884: GMP synthase (glutamine-hydrolyzing), C-terminal domain
  • amino acids 208 to 530 (323 residues), 474.3 bits, E=1.7e-146
• PF02540: NAD_synthase
  • amino acids 222 to 296 (75 residues), 26.8 bits, E=8.5e-10
• PF03054: tRNA_Me_trans
  • amino acids 225 to 295 (71 residues), 21.3 bits, E=5.7e-08
• PF00958: GMP_synt_C
  • amino acids 438 to 529 (92 residues), 142.9 bits, E=7.9e-46

Best Hits

Swiss-Prot: 86% identical to GUAA_STRMK: GMP synthase [glutamine-hydrolyzing] (guaA) from Stenotrophomonas maltophilia (strain K279a)

KEGG orthology group: K01951, GMP synthase (glutamine-hydrolysing) [EC: 6.3.5.2] (inferred from 86% identity to xal:XALc_1579)

MetaCyc: 51% identical to GMP synthase monomer (Saccharomyces cerevisiae)
GMP synthase (glutamine-hydrolyzing). [EC: 6.3.5.2]

Predicted SEED Role

"GMP synthase [glutamine-hydrolyzing] (EC 6.3.5.2)" in subsystem Purine conversions or Staphylococcal pathogenicity islands SaPI (EC 6.3.5.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (44/46 steps found)
• superpathway of purine nucleotides de novo biosynthesis I (21/21 steps found)
• superpathway of purine nucleotides de novo biosynthesis II (24/26 steps found)
• superpathway of purine nucleotide salvage (14/14 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis I (6/6 steps found)
• superpathway of guanosine nucleotides de novo biosynthesis II (7/8 steps found)
• guanosine ribonucleotides de novo biosynthesis (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-citrulline biosynthesis (6/8 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• superpathway of L-citrulline metabolism (8/12 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (1/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (1/4 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Drug metabolism - other enzymes
• Glutamate metabolism
• Purine metabolism

Isozymes

Compare fitness of predicted isozymes for: 6.3.5.2

Use Curated BLAST to search for 6.3.5.2

Protein Sequence (530 amino acids)

>LRK53_RS11155 glutamine-hydrolyzing GMP synthase (Rhodanobacter sp000427505 FW510-R12)
MQSIHSDKILILDFGAQYTQLIARRVREFGVYCEIWAWDHDPAEIAAFGAKGIILSGGPE
STTLKGAPKAPQEVFDSGLPILGICYGMQTLAAQLGGATEAADAREFGHASVDVVAPSRL
FDGLTDHPGEHKLDVWMSHGDHVSKAPPGFAITGRTDRIPVAVMENEARRWYGVQFHPEV
THTKQGGALLKRFITEICGCATLWTAANIIDDQIARVRALVGDDHVLLGLSGGVDSSVVA
ALLHKAIGDRLTCVFVDTGLLRWQEGDQVMATMAAAADQHGMGVKVIRVNAAERYFKALE
GVADPEAKRKIIGGLFVEIFDEESEKLIAAGGKVKWLAQGTIYPDVIESAGSKTGKAHVI
KSHHNVGGLPAHMKLKLVEPLRELFKDEVRRIGVELGLPRAMVYRHPFPGPGLGVRILGE
VKREYAELLTQADAIFIDELRKADLYDRTSQAFAVFLPVKSVGVVGDARAYEWVIALRAV
ETIDFMTAHWAHLPYEFLGKVSNRIINELRGVSRVVYDISGKPPATIEWE