Protein Info for LRK53_RS11070 in Rhodanobacter sp000427505 FW510-R12

Annotation: MBL fold metallo-hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 PF00753: Lactamase_B" amino acids 21 to 204 (184 residues), 60.5 bits, see alignment E=4.6e-20 PF12706: Lactamase_B_2" amino acids 30 to 215 (186 residues), 36 bits, see alignment E=1.1e-12 PF10996: Beta-Casp" amino acids 253 to 372 (120 residues), 118 bits, see alignment E=7.4e-38 PF07521: RMMBL" amino acids 385 to 449 (65 residues), 67.4 bits, see alignment E=1.8e-22

Best Hits

KEGG orthology group: K07576, metallo-beta-lactamase family protein (inferred from 66% identity to npp:PP1Y_AT24035)

Predicted SEED Role

"Metallo-beta-lactamase family protein, RNA-specific" in subsystem Bacterial RNA-metabolizing Zn-dependent hydrolases

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (461 amino acids)

>LRK53_RS11070 MBL fold metallo-hydrolase (Rhodanobacter sp000427505 FW510-R12)
MNNATDSTLQFLGAAGTVTGSRYLIEAGGHRVLVDCGLFQGYKQLRERNWAPFPVAPDSI
DAVVLTHAHLDHSGYLPALVRQGFRGTIHCTTGSVALCGLLLPDSGHLLEEEAKYAARKG
YSKHAKPLPLYTKEDAERSLRQLHGHDYERDVEVVAGIRARFYPAGHILGAAHVSLDVHG
RRLHFSGDLGRQHESLMNPPTPLPACDVLVCESTYGNRAHVPIDQEAELAPIVRRVAARG
GVIVIPAFAVGRAQALMLHLARLRQRNEIPPVPVFLNSPMAVDATRLYHEHHAEHHVSDE
DCRRMYEIATFVNSVEESKALNRRREPMIIISASGMATGGRVLHHIEAFGPDDRNAIVLS
GYQAGGTRGAALAGGAHTLRMFGREVPIRAEVIPLAGFSGHADANELLAWMRTTPSAPEM
VYVTHGEPDASDTLRARIEHELGWHARAPEHMERVSLEGAN