Protein Info for LRK53_RS10960 in Rhodanobacter sp000427505 FW510-R12

Annotation: DNA mismatch repair protein MutS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 513 transmembrane" amino acids 104 to 125 (22 residues), see Phobius details PF00488: MutS_V" amino acids 326 to 449 (124 residues), 58.8 bits, see alignment E=3.8e-20

Best Hits

KEGG orthology group: None (inferred from 53% identity to txy:Thexy_0593)

Predicted SEED Role

"MutS domain protein, family 4" in subsystem DNA repair, bacterial MutL-MutS system

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (513 amino acids)

>LRK53_RS10960 DNA mismatch repair protein MutS (Rhodanobacter sp000427505 FW510-R12)
MKALLMHPDRDFDVQGPMPEHESDLRQDLALDVLLDAMAAEDPFLFEVARKALLLSSGND
IDTVVYRQDIVRDALAHPDVLRQCYDLAVEAIEGKRKSHWGFAGHYPSSILYGAVCVLGI
FMTVLEKLRELVVAHGASFESTGLKALCAMLQSEFDDAYLARVRTHLIELKLDKGVLLSA
QLSQGNEGTNYALREAAYSQPYWLDRLWSKRESGYTFRIADRDQAGAQALSELRNRGINE
VANALAQAMDHILGFFEMLRAELAFYVGCVNLHAKLTALGVTNCFPQVAGTRRLQFRGLC
DASLALSMGRSVVGNALDADDKQLAIVTGANQGGKSSFLRSVGLAQLMMQSGMFVAAESF
AGELCAGLFTHAKREEDATLRSGKFDEELRRLSAIVDRLRPGAVVLFNESFASTNELEGS
EIARQVVGALLERGIKVFFVTHLYTFARGLFDHPPDGAIFLRAERLDDGRRTFRIIEGEP
LQTSHGVDLYREVFGDDTVRTGDLMAAAQAGTG