Protein Info for LRK53_RS10855 in Rhodanobacter sp000427505 FW510-R12

Annotation: cation diffusion facilitator family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 318 transmembrane" amino acids 28 to 49 (22 residues), see Phobius details amino acids 60 to 78 (19 residues), see Phobius details amino acids 98 to 117 (20 residues), see Phobius details amino acids 129 to 149 (21 residues), see Phobius details amino acids 170 to 187 (18 residues), see Phobius details amino acids 193 to 211 (19 residues), see Phobius details TIGR01297: cation diffusion facilitator family transporter" amino acids 25 to 298 (274 residues), 239.1 bits, see alignment E=3e-75 PF01545: Cation_efflux" amino acids 28 to 218 (191 residues), 141.4 bits, see alignment E=3.3e-45 PF16916: ZT_dimer" amino acids 230 to 297 (68 residues), 40.2 bits, see alignment E=2.8e-14

Best Hits

Swiss-Prot: 38% identical to CZCD_BACVZ: Cadmium, cobalt and zinc/H(+)-K(+) antiporter (czcD) from Bacillus velezensis (strain DSM 23117 / BGSC 10A6 / FZB42)

KEGG orthology group: K03295, cation efflux system protein, CDF family (inferred from 67% identity to mab:MAB_0183c)

MetaCyc: 35% identical to Zn2+/Cd2+/Ni2+/Cu2+ exporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-200

Predicted SEED Role

"Cobalt-zinc-cadmium resistance protein CzcD" in subsystem Cobalt-zinc-cadmium resistance

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (318 amino acids)

>LRK53_RS10855 cation diffusion facilitator family transporter (Rhodanobacter sp000427505 FW510-R12)
MGTTKPHEHDHHHDHSHGVAPDADKKYLTIALLLLLGFMAVEVVVGILAKSLALISDAGH
MLTDVGSIGLALVAMRLASRPASGSYTFGLKRVEILSAQANGLTLLLLSVWFIVEAIRRL
IDPPVVEGLLVTVIAVVGIGVNLLAVWAMSKANRQSLNVEGSFQHILTDLYAFIATAIAG
AIIWWTGWNRVDSLAALVVAGLMLKAGIGLVRDSGRIFLEAAPRGLDPVSIAEAIRAMPA
VTRLDDLHVWEVTSGMPALSGHIYVNHDIDCHDVRREIEAMLHDRFAITHTTLQTDHATT
DESARATGCTFTSPGAAH