Protein Info for LRK53_RS10735 in Rhodanobacter sp000427505 FW510-R12

Annotation: SDR family oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00106: adh_short
  • amino acids 14 to 210 (197 residues), 182.9 bits, E=7.4e-58
• PF08659: KR
  • amino acids 15 to 177 (163 residues), 60.4 bits, E=3.3e-20
• PF13561: adh_short_C2
  • amino acids 23 to 259 (237 residues), 187.3 bits, E=5.2e-59

Best Hits

Swiss-Prot: 38% identical to DHK1_STRVN: Granaticin polyketide synthase putative ketoacyl reductase 1 (gra-orf5) from Streptomyces violaceoruber

KEGG orthology group: K00046, gluconate 5-dehydrogenase [EC: 1.1.1.69] (inferred from 70% identity to reu:Reut_A1409)

MetaCyc: 36% identical to cyclopentanol dehydrogenase (Comamonas sp. NCIMB 9872)
Cyclopentanol dehydrogenase. [EC: 1.1.1.163]

Predicted SEED Role

"3-oxoacyl-[acyl-carrier protein] reductase (EC 1.1.1.100)" in subsystem Fatty Acid Biosynthesis FASII or mycolic acid synthesis (EC 1.1.1.100)

MetaCyc Pathways

• superpathway of fatty acids biosynthesis (E. coli) (49/53 steps found)
• superpathway of fatty acid biosynthesis II (plant) (38/43 steps found)
• palmitate biosynthesis II (type II fatty acid synthase) (29/31 steps found)
• superpathway of unsaturated fatty acids biosynthesis (E. coli) (18/20 steps found)
• biotin biosynthesis I (14/15 steps found)
• oleate biosynthesis IV (anaerobic) (13/14 steps found)
• superpathway of fatty acid biosynthesis I (E. coli) (14/16 steps found)
• 8-amino-7-oxononanoate biosynthesis I (10/11 steps found)
• (5Z)-dodecenoate biosynthesis I (6/6 steps found)
• palmitoleate biosynthesis I (from (5Z)-dodec-5-enoate) (8/9 steps found)
• 8-amino-7-oxononanoate biosynthesis IV (5/5 steps found)
• gondoate biosynthesis (anaerobic) (4/4 steps found)
• (5Z)-dodecenoate biosynthesis II (5/6 steps found)
• stearate biosynthesis II (bacteria and plants) (5/6 steps found)
• cis-vaccenate biosynthesis (4/5 steps found)
• fatty acid elongation -- saturated (4/5 steps found)
• octanoyl-[acyl-carrier protein] biosynthesis (mitochondria, yeast) (9/12 steps found)
• palmitate biosynthesis III (21/29 steps found)
• stearate biosynthesis IV (4/6 steps found)
• anteiso-branched-chain fatty acid biosynthesis (24/34 steps found)
• even iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• odd iso-branched-chain fatty acid biosynthesis (24/34 steps found)
• tetradecanoate biosynthesis (mitochondria) (17/25 steps found)
• L-idonate degradation (1/3 steps found)
• petroselinate biosynthesis (2/6 steps found)
• 2-allylmalonyl-CoA biosynthesis (2/8 steps found)
• streptorubin B biosynthesis (20/34 steps found)
• ketogluconate metabolism (1/8 steps found)
• mycolate biosynthesis (20/205 steps found)
• superpathway of mycolate biosynthesis (21/239 steps found)

KEGG Metabolic Maps

• Biosynthesis of unsaturated fatty acids
• Fatty acid biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.100

Use Curated BLAST to search for 1.1.1.100 or 1.1.1.163 or 1.1.1.69

Protein Sequence (261 amino acids)

>LRK53_RS10735 SDR family oxidoreductase (Rhodanobacter sp000427505 FW510-R12)
MTNLTRTLFNLDGQTALITGGSRGLGLQIAEALGDYGARILLSARKADELKQAQAHLQRR
GIESEWVVADVAQPESVHALVDAALARMGRIDVLVNNAGTSWGAPAEDHPLEAWDKVFDL
NVRGLFLLSQQVGKRSMIVHGHGRIINIASIAGLRGNPPGSMQTIAYNSAKAAVVNFTRS
LAGEWGIHGITVNAIAPGFFPSKMTRGLIEQVGEEALLGNAPLRRIGGEQDLKGAALLFA
SGAGSHITGQVLAVDGGYTAV