Protein Info for LRK53_RS10690 in Rhodanobacter sp000427505 FW510-R12

Annotation: NADPH:quinone oxidoreductase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 331 PF08240: ADH_N" amino acids 26 to 109 (84 residues), 57 bits, see alignment E=3e-19 PF00107: ADH_zinc_N" amino acids 154 to 271 (118 residues), 96.5 bits, see alignment E=1.8e-31 PF13602: ADH_zinc_N_2" amino acids 187 to 325 (139 residues), 65.8 bits, see alignment E=1.2e-21

Best Hits

KEGG orthology group: K00344, NADPH2:quinone reductase [EC: 1.6.5.5] (inferred from 59% identity to reh:H16_A2377)

Predicted SEED Role

No annotation

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.6.5.5

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (331 amino acids)

>LRK53_RS10690 NADPH:quinone oxidoreductase family protein (Rhodanobacter sp000427505 FW510-R12)
MKAIVCETWGPPSSLQLRDLPSPVPGPRQVLVRTRVAAVNFPDALIVAGKYQAKPAFPFS
PGGELSGEIIAVGAEVKHLAIGDKVVGLTQYGAWAQEVAVDATRVVPLPADIGDDELELA
GSFMLTYGTSLHALKDRANAQSGETLLVLGAGGGVGLAAVELGKLLGMRVIAAASTIEKL
AAASEHGADECINYSHEDLRERIKALTEGRGVDVVYDPVGGNFTEPALRSVNWRGRYLVV
GFATGDIPKIPVNLLLLKGSALLGVFWGEFVRREPTLNAKNIGQLMGWLHEQRIHPLISH
RYSLAQAPLALDALLGREAIGKLVVLPQKVD