Protein Info for LRK53_RS10625 in Rhodanobacter sp000427505 FW510-R12

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00561: Abhydrolase_1
  • amino acids 28 to 138 (111 residues), 68.3 bits, E=1.3e-22
• PF12697: Abhydrolase_6
  • amino acids 29 to 151 (123 residues), 60.8 bits, E=4.6e-20
• PF12146: Hydrolase_4
  • amino acids 29 to 134 (106 residues), 27.5 bits, E=2.8e-10

Predicted SEED Role

"Beta-ketoadipate enol-lactone hydrolase (EC 3.1.1.24)" in subsystem Catechol branch of beta-ketoadipate pathway or Chloroaromatic degradation pathway or Protocatechuate branch of beta-ketoadipate pathway (EC 3.1.1.24)

MetaCyc Pathways

• catechol degradation to β-ketoadipate (1/4 steps found)
• protocatechuate degradation II (ortho-cleavage pathway) (1/4 steps found)
• catechol degradation III (ortho-cleavage pathway) (1/6 steps found)
• 4-methylcatechol degradation (ortho cleavage) (1/7 steps found)
• superpathway of salicylate degradation (1/7 steps found)
• aromatic compounds degradation via β-ketoadipate (1/9 steps found)
• toluene degradation III (aerobic) (via p-cresol) (2/11 steps found)
• mandelate degradation to acetyl-CoA (7/18 steps found)
• superpathway of aerobic toluene degradation (13/30 steps found)
• superpathway of aromatic compound degradation via 3-oxoadipate (11/35 steps found)

KEGG Metabolic Maps

• Benzoate degradation via hydroxylation

Isozymes

Compare fitness of predicted isozymes for: 3.1.1.24

Use Curated BLAST to search for 3.1.1.24

Protein Sequence (164 amino acids)

>LRK53_RS10625 alpha/beta hydrolase (Rhodanobacter sp000427505 FW510-R12)
MNISQPHFVDTQRGRFAYREGGEAAGGPLVMIHGWPESSYCWKHLAGYLRPGLRIIAPDL
QGLGNSERTEGLAHYLKVELARDVVEVLGALGAFDFQLVGHDWGGIVAQEIAMAMPVRVR
RLILLNIAVIDNPEGNREVIRVLRERGSRSTGTGIFSRRRDWLR