Protein Info for LRK53_RS10530 in Rhodanobacter sp000427505 FW510-R12

Annotation: acyl-CoA dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02771: Acyl-CoA_dh_N
  • amino acids 6 to 107 (102 residues), 42.2 bits, E=2e-14
• PF02770: Acyl-CoA_dh_M
  • amino acids 121 to 205 (85 residues), 53.1 bits, E=5.9e-18
• PF00441: Acyl-CoA_dh_1
  • amino acids 241 to 367 (127 residues), 88.7 bits, E=8.9e-29
• PF08028: Acyl-CoA_dh_2
  • amino acids 242 to 347 (106 residues), 27.4 bits, E=7.5e-10

Best Hits

KEGG orthology group: K00257, [EC: 1.3.99.-] (inferred from 76% identity to rfr:Rfer_2592)

MetaCyc: 46% identical to pimeloyl-CoA dehydrogenase small subunit (Rhodopseudomonas palustris)
Pimeloyl-CoA dehydrogenase. [EC: 1.3.1.62]

Predicted SEED Role

"Acyl-CoA dehydrogenase family protein"

MetaCyc Pathways

• benzoyl-CoA degradation III (anaerobic) (1/9 steps found)

KEGG Metabolic Maps

• 1- and 2-Methylnaphthalene degradation
• Benzoate degradation via CoA ligation
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Brassinosteroid biosynthesis
• Caprolactam degradation
• Fatty acid metabolism
• Geraniol degradation
• Valine, leucine and isoleucine degradation

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.-

Use Curated BLAST to search for 1.3.1.62 or 1.3.99.-

Protein Sequence (377 amino acids)

>LRK53_RS10530 acyl-CoA dehydrogenase family protein (Rhodanobacter sp000427505 FW510-R12)
MNFEHTEDRRMLEDSLGRFVKEQYGFETRDRIARSAQGYSPEMWRQFADLGVIGALFTEA
NGGFGGAGFDIAVVFEALGRRLVVEPFLGSAVLAGGAIATAGSEAQRVLLAEIIGGTCIA
AFAHNEPDARYELTHAQTRAERAGDGWVLNGAKAVVQQGESADLFVVSARSAGAIDDEAG
LSLFLVPAKAVGVSLRGYPTIDGGRAAEVALHGVRLGADALLGVAGAAFATIEKVVGTGL
LALCAESLGAMDAAKEATLEHLRTRKQFGVPIGSFQALQHRMADLLLEIEQARSAVINAA
AALDADRVTRERALSAAKFTIGRAGTLVAEEIIQLHGAIGMTWELPLAHYAKRLVMIDHL
FGDEDHHLERYIALGRG