Protein Info for LRK53_RS10275 in Rhodanobacter sp000427505 FW510-R12

Annotation: 2-oxopent-4-enoate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 58% identical to TESE_COMTE: 2-hydroxyhexa-2,4-dienoate hydratase (tesE) from Comamonas testosteroni

KEGG orthology group: K02554, 2-keto-4-pentenoate hydratase [EC: 4.2.1.80] (inferred from 76% identity to mpt:Mpe_A2273)

MetaCyc: 75% identical to 2-oxopent-4-enoate hydratase (Comamonas testosteroni CNB-1)
2-oxopent-4-enoate hydratase. [EC: 4.2.1.80]; 4.2.1.80 [EC: 4.2.1.80]

Predicted SEED Role

"4-oxalocrotonate decarboxylase (EC 4.1.1.77)" in subsystem Benzoate transport and degradation cluster (EC 4.1.1.77)

MetaCyc Pathways

L-tryptophan degradation IX (11/12 steps found)
toluene degradation I (aerobic) (via o-cresol) (7/7 steps found)
catechol degradation I (meta-cleavage pathway) (5/5 steps found)
L-tryptophan degradation XII (Geobacillus) (10/12 steps found)
2-amino-3-carboxymuconate semialdehyde degradation to 2-hydroxypentadienoate (4/4 steps found)
2-hydroxypenta-2,4-dienoate degradation (3/3 steps found)
2-aminophenol degradation (3/4 steps found)
2-nitrobenzoate degradation I (5/7 steps found)
catechol degradation II (meta-cleavage pathway) (5/7 steps found)
toluene degradation V (aerobic) (via toluene-cis-diol) (5/7 steps found)
meta cleavage pathway of aromatic compounds (7/10 steps found)
3-chlorocatechol degradation III (meta pathway) (2/4 steps found)
catechol degradation to 2-hydroxypentadienoate II (2/4 steps found)
toluene degradation II (aerobic) (via 4-methylcatechol) (3/6 steps found)
orthanilate degradation (2/5 steps found)
protocatechuate degradation III (para-cleavage pathway) (2/5 steps found)
4-amino-3-hydroxybenzoate degradation (2/6 steps found)
toluene degradation IV (aerobic) (via catechol) (7/13 steps found)
4-nitrotoluene degradation II (4/9 steps found)
2,3-dihydroxybenzoate degradation (1/5 steps found)
3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (3/8 steps found)
p-cumate degradation (3/8 steps found)
4-chloronitrobenzene degradation (3/9 steps found)
naphthalene degradation to acetyl-CoA (5/12 steps found)
p-cymene degradation (3/11 steps found)
mandelate degradation to acetyl-CoA (7/18 steps found)
2,2'-dihydroxybiphenyl degradation (1/10 steps found)
superpathway of aerobic toluene degradation (13/30 steps found)
superpathway of aromatic compound degradation via 3-oxoadipate (11/35 steps found)
superpathway of aromatic compound degradation via 2-hydroxypentadienoate (14/42 steps found)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.77

Use Curated BLAST to search for 4.1.1.77 or 4.2.1.80

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (260 amino acids)

>LRK53_RS10275 2-oxopent-4-enoate hydratase (Rhodanobacter sp000427505 FW510-R12)
MKPQDIRKHGDELYEALAARRAVAPLTDRVPDIDIDDAYRIQLRMIERRIEQGETVVGKK
IGVTSKAVQNMLKVYQPDFGQLLSGMVYSEGEPIPVDTLIAPKAEAEVAFILKADLNGPG
ISAADVLRATDFVLPCFEIVDSRIQDWKIKIQDTVADNASCGVFVLGGTPRSLRGLDLAV
AGMVVEKNGDVVSTAAGAAVQGSPVNAVAWLANTLGTLGIPLKAGEVILSGSQSPLMPVV
AGDSFHCSVGGLGSCSVRFA