Protein Info for LRK53_RS10220 in Rhodanobacter sp000427505 FW510-R12

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 407 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 50 to 69 (20 residues), see Phobius details amino acids 84 to 112 (29 residues), see Phobius details amino acids 140 to 163 (24 residues), see Phobius details amino acids 171 to 190 (20 residues), see Phobius details amino acids 222 to 244 (23 residues), see Phobius details amino acids 256 to 276 (21 residues), see Phobius details amino acids 288 to 306 (19 residues), see Phobius details amino acids 312 to 334 (23 residues), see Phobius details amino acids 346 to 368 (23 residues), see Phobius details amino acids 379 to 399 (21 residues), see Phobius details PF07690: MFS_1" amino acids 19 to 362 (344 residues), 110.8 bits, see alignment E=3.7e-36

Best Hits

KEGG orthology group: None (inferred from 72% identity to smk:Sinme_6546)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (407 amino acids)

>LRK53_RS10220 MFS transporter (Rhodanobacter sp000427505 FW510-R12)
MKDHARFVRENLRWIGGGFLLMFFSSFGQTFFVGLFGTDLRAQFHLSDGQFGGLYTVATL
ASALTLPWAGRTLDLMPGWKVARFSIVGLAIACVLVGVAPHVIVLAFALYLLRLFGQGMM
TEIAFTEVGRWFNANRGRAMALIVPGVQAGSALLPVAVVLMVKLGGWRTPWLVSAALLML
VGYPLIIGLLRIERVPRSHELDAGRQRTARDWTRREVVRDPVFYLLLAGTLAPPFIGTTI
FFHQGYLIALRGYDPLVFAAAFPVMAVTTVLFGLLCGHMIDRFGALRLLPFFLAPLAVAS
AAVGLVTPAWGIYLFMFLLGISNGFTQTLLGALWPEVYGLANLGGIRAIIVAAMVLATAL
GPGLTGVLIDLGLPLPGQMLWMALWCMVASLAMAMASRAVRLRECRA