Protein Info for LRK53_RS10210 in Rhodanobacter sp000427505 FW510-R12

Annotation: universal stress protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 284 PF00582: Usp" amino acids 1 to 156 (156 residues), 44.9 bits, see alignment E=8.9e-16 amino acids 165 to 284 (120 residues), 51 bits, see alignment E=1.2e-17

Best Hits

Swiss-Prot: 38% identical to Y1230_SYNY3: Universal stress protein Slr1230 (slr1230) from Synechocystis sp. (strain PCC 6803 / Kazusa)

KEGG orthology group: None (inferred from 49% identity to smk:Sinme_6551)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (284 amino acids)

>LRK53_RS10210 universal stress protein (Rhodanobacter sp000427505 FW510-R12)
MKTLLACLDDSIYTQSVIDHAVWAAGRLDAQLELMHTLERHPERAQTSNLSGSIGLGAKS
DLLSELATLDEQRSKLSLQHGHALLSSAAERARQQGAANVHERLRHGDLIDALVEFEPTY
NLLVIGKRGASADMAKLHLGSSLERAVRAIHRPILVASRVFKPIERLLIAFDGSASARKA
VELAAHSPLLAGLECHLVMAGAESPAHAAHMAWARELLDAAGIAIRAETIPGHADAVIAD
YVRSHHIDLVTMGAYGHSRVRQLIVGSTTTTMVRSCLVPILLVR