Protein Info for LRK53_RS10180 in Rhodanobacter sp000427505 FW510-R12

Annotation: peptide chain release factor 3

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 536 TIGR00503: peptide chain release factor 3" amino acids 10 to 526 (517 residues), 811.5 bits, see alignment E=2.7e-248 PF00009: GTP_EFTU" amino acids 13 to 275 (263 residues), 166.4 bits, see alignment E=1.5e-52 PF01926: MMR_HSR1" amino acids 14 to 141 (128 residues), 25.6 bits, see alignment E=2.8e-09 TIGR00231: small GTP-binding protein domain" amino acids 15 to 154 (140 residues), 72.8 bits, see alignment E=2.7e-24 PF22042: EF-G_D2" amino acids 294 to 379 (86 residues), 73 bits, see alignment E=4.5e-24 PF03144: GTP_EFTU_D2" amino acids 312 to 377 (66 residues), 34.3 bits, see alignment E=6.7e-12 PF16658: RF3_C" amino acids 385 to 512 (128 residues), 154.5 bits, see alignment E=3.3e-49

Best Hits

Swiss-Prot: 75% identical to RF3_XANC5: Peptide chain release factor 3 (prfC) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K02837, peptide chain release factor 3 (inferred from 75% identity to xcv:XCV3179)

Predicted SEED Role

"Peptide chain release factor 3"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (536 amino acids)

>LRK53_RS10180 peptide chain release factor 3 (Rhodanobacter sp000427505 FW510-R12)
MNVSQNSPAPRKTFAIISHPDAGKTTLTEKLLLFGGAIRQAGSVKSRKTTRHATSDWMAL
EKERGISVTSSVMQFPYEGTIVNLLDTPGHADFSEDTYRVLTAVDSALMVIDCAKGVEER
TIKLMEVCRLRDTPIMTFINKLDREGRSPIELLDEVESLLGIACAPVTWPIGMGQRLKGV
YHLLLDEVHVFEPGKNFTRQDSMIFQGLEHPELEARIGTDTLRELHGELELVKGASHPFD
PAAYRAGRQTPVFFGSAVNNFGVQLLLDFFVAHAPGPQPREAIPRRVSPTEKSVTGFVFK
IQANMDPLHRDRIAFMRLCSGCYHPGVRLRHVRTGKDVRVSDALTFMASERGLIEEAWPG
DVIGLHNHGTIAIGDTFSEGEMLQFTGIPHFAPELFRRVHLKDPLRLKQLHKGLQQLSEE
GATQFFRSVASNDLLLGAVGVLQFEVAAYRLAQEYGVHALFEPTNAITARWVHCDDSDAL
EEFSAKNAHQLARDAANALVYLATSRVNLQMTQERWPQIRFAATRDQSLVEAAIHA