Protein Info for LRK53_RS10065 in Rhodanobacter sp000427505 FW510-R12

Annotation: bifunctional TVP38/TMEM64 family protein/FAD-dependent oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 713 transmembrane" amino acids 7 to 28 (22 residues), see Phobius details amino acids 56 to 80 (25 residues), see Phobius details amino acids 91 to 112 (22 residues), see Phobius details amino acids 137 to 160 (24 residues), see Phobius details amino acids 167 to 187 (21 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 244 to 263 (20 residues), see Phobius details PF09335: VTT_dom" amino acids 74 to 188 (115 residues), 78.3 bits, see alignment E=2.2e-25 PF07992: Pyr_redox_2" amino acids 243 to 557 (315 residues), 196.6 bits, see alignment E=2e-61 PF01134: GIDA" amino acids 244 to 309 (66 residues), 19.7 bits, see alignment E=1.2e-07 PF00070: Pyr_redox" amino acids 408 to 478 (71 residues), 54 bits, see alignment E=6e-18 PF02852: Pyr_redox_dim" amino acids 579 to 687 (109 residues), 101.4 bits, see alignment E=1e-32

Best Hits

KEGG orthology group: K00520, mercuric reductase [EC: 1.16.1.1] (inferred from 62% identity to noc:Noc_0589)

Predicted SEED Role

"COG0398: uncharacterized membrane protein / PF00070 family, FAD-dependent NAD(P)-disulphide oxidoreductase" in subsystem Mercuric reductase

MetaCyc Pathways

Isozymes

Compare fitness of predicted isozymes for: 1.16.1.1

Use Curated BLAST to search for 1.16.1.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (713 amino acids)

>LRK53_RS10065 bifunctional TVP38/TMEM64 family protein/FAD-dependent oxidoreductase (Rhodanobacter sp000427505 FW510-R12)
MKNRTTILRWLIVIGLSGAVVVFFALGWQHQFTLAALKAHLLALDAFRQTHPWLLGGGFF
LLYVAVTALSLPVATLLTLAGGATFGLLEGTLLVSFASSIGATLAFLASRFVFRDVVQRR
FGQRLHAVDEGIRREGALYLFTLRLVPVIPFFVVNLLMGLTRLPIRAFYWVSQLGMLAAT
VVFVNAGTQLARLHSLSGIVSPRIAGSLVLLGVFPWLARGSVAWVKRRRLYAGWPAPKRF
DRNLVVIGAGSAGLVSAYIAAAVRAKVTLVESDAMGGDCLNTGCVPSKALIHAARLAAQA
RSAARVGVDAGDIRVDFRAVMDSVRRAVQAVAPHDSVERYRGLGADVQHGHARIVSPWAV
EIDGRPVTTRAIVIATGAEPMVPDLPGLAEAGYLTSETLWQLQDPPGRLLVLGGGPIGCE
LAQAFARLGTQVVQVQSHGRLLVREDDEVSAFVRARLSADGVDVRTDCRALAVERDGGQY
ALVCDHQGRRARIPFDTLLVAVGRKPRVAGFGLEELGISVTRTVDTDAWMATLYPNIYAC
GDVAGPYQFTHVAAHQAWYAAVNALFGSIWRFRVDYAVIPAVTFVDPEVARVGLNEREAQ
ARGIAFETTRYELDDLDRAITEDQAHGFVKVLTAPGKDRILGATIVGQHAGEMLAEFVLA
MRHGLGLNKILGTIHAYPTWAEANKYAAGNWKKAHAPERVLRWLARYHAWRRK