Protein Info for LRK53_RS10005 in Rhodanobacter sp000427505 FW510-R12

Annotation: cysteine hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 246 signal peptide" amino acids 1 to 24 (24 residues), see Phobius details PF00857: Isochorismatase" amino acids 37 to 237 (201 residues), 97.6 bits, see alignment E=4.6e-32

Best Hits

KEGG orthology group: None (inferred from 61% identity to cps:CPS_1616)

Predicted SEED Role

"Isochorismatase (EC 3.3.2.1)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. (EC 3.3.2.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.3.2.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (246 amino acids)

>LRK53_RS10005 cysteine hydrolase (Rhodanobacter sp000427505 FW510-R12)
MQKTLALLAASVGIGFAAGPAHAQLPKTTMQVDHANTALVVIDPQVDFLSPKGVTWGLVG
KSVVANHTVENLDTLFKAAKDSNMQVVISPHYYYPWDHGWKFGGPLEVAMHKIGMFDRKG
PLSLDGFENSGADWMPQYKKYINDGKTIVTSPHKVYGPQTNDLALQLRKHGISKVILAGM
SANLCVESHLRELLEQGFEVEVVKDATAAAQLPGLDGYAAALTNFQMIANDVVTTQEAKD
AILATR