Protein Info for LRK53_RS09715 in Rhodanobacter sp000427505 FW510-R12

Annotation: tRNA 2-thiouridine(34) synthase MnmA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 379 PF03054: tRNA_Me_trans" amino acids 2 to 193 (192 residues), 251.2 bits, see alignment E=1.5e-78 PF02540: NAD_synthase" amino acids 2 to 66 (65 residues), 22.8 bits, see alignment E=9.2e-09 TIGR00420: tRNA (5-methylaminomethyl-2-thiouridylate)-methyltransferase" amino acids 2 to 350 (349 residues), 418 bits, see alignment E=1.3e-129 PF20259: tRNA_Me_trans_M" amino acids 199 to 266 (68 residues), 73.6 bits, see alignment E=1.5e-24 PF20258: tRNA_Me_trans_C" amino acids 276 to 350 (75 residues), 83.1 bits, see alignment E=3e-27

Best Hits

Swiss-Prot: 68% identical to MNMA_XANC5: tRNA-specific 2-thiouridylase MnmA (mnmA) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K00566, tRNA-specific 2-thiouridylase [EC: 2.8.1.-] (inferred from 68% identity to xcv:XCV2046)

MetaCyc: 61% identical to tRNA-specific 2-thiouridylase (Escherichia coli K-12 substr. MG1655)
RXN0-2023 [EC: 2.8.1.13]

Predicted SEED Role

"tRNA-specific 2-thiouridylase MnmA"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.- or 2.8.1.13

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (379 amino acids)

>LRK53_RS09715 tRNA 2-thiouridine(34) synthase MnmA (Rhodanobacter sp000427505 FW510-R12)
MLGISGGVDSSVAALLLQQAGYQVEGLFMQNWEEDERSGPCTTDADRKDAVAVCGRLGIP
FHTRNFAAEYWDGVFEHFLAEYRAGRTPNPDVLCNREIKFKTFLDEARTLGAEKIATGHY
ARVDCKDGRYRLLRAVDAAKDQSYFLHALGQQQLAATLFPLGGIEKPRVREMARAAGLPT
HAKKDSTGICFIGERDFRGFLAQYIPARPGEMRTPAGELVGEHQGAMYYTLGQRNGLGIG
GRHGAGGEAWYVVGKDVAANVLYVAQGGENRWLYSRRLRSELPSWIAGAAPATHFRCTAR
TRYRQADQACEVGVTDDGLEVRFDEPQRAVTPGQSVVLYDGEVCLGGAVIAATDAPYGSL
LPPFQSFPTHPAGESQARV