Protein Info for LRK53_RS09690 in Rhodanobacter sp000427505 FW510-R12

Annotation: phosphate ABC transporter permease subunit PstC

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 339 transmembrane" amino acids 27 to 52 (26 residues), see Phobius details amino acids 84 to 109 (26 residues), see Phobius details amino acids 121 to 148 (28 residues), see Phobius details amino acids 188 to 209 (22 residues), see Phobius details amino acids 250 to 273 (24 residues), see Phobius details amino acids 307 to 330 (24 residues), see Phobius details TIGR02138: phosphate ABC transporter, permease protein PstC" amino acids 25 to 332 (308 residues), 301.4 bits, see alignment E=2.8e-94 PF00528: BPD_transp_1" amino acids 108 to 333 (226 residues), 60.7 bits, see alignment E=8.1e-21

Best Hits

Predicted SEED Role

"Phosphate transport system permease protein PstC (TC 3.A.1.7.1)" in subsystem High affinity phosphate transporter and control of PHO regulon or Phosphate metabolism (TC 3.A.1.7.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (339 amino acids)

>LRK53_RS09690 phosphate ABC transporter permease subunit PstC (Rhodanobacter sp000427505 FW510-R12)
MPATETAIPAPDILEQRSRRDARHEQLFRWLLKGCALLVLASLLGAAGATLWGGRDAFSA
FGWHFLVSAEWDPGNEVYGALVPVYGTVVTSFIALLIAVPISFGIAVYLSEVAPTWLRTP
VASAIELLAGIPSIIYGMWGLFIFAPFFADHIKPWLTSNLGNKPDDGKLSWVAEHVPLIG
KLFGSDYPFGASILVAGIVLAIMVIPFISSVMREVFQTVPTRLKESAYALGSSTWEVSWD
IVLPYTRSAVIGGIFLGLGRALGETMAVTFVLGNAMHLSASLLDPGASIASTIANQFSEA
VGLQKSALMALAFLLFVVTFIVLLIARLMLRRLASKEGR