Protein Info for LRK53_RS09560 in Rhodanobacter sp000427505 FW510-R12

Annotation: D-amino acid dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 426 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details PF01266: DAO" amino acids 2 to 398 (397 residues), 282.2 bits, see alignment E=3e-87 PF02558: ApbA" amino acids 3 to 35 (33 residues), 23.1 bits, see alignment (E = 1.8e-08) PF13450: NAD_binding_8" amino acids 5 to 35 (31 residues), 23.7 bits, see alignment (E = 1.7e-08)

Best Hits

Swiss-Prot: 79% identical to DADA_AZOVD: D-amino acid dehydrogenase (dadA) from Azotobacter vinelandii (strain DJ / ATCC BAA-1303)

KEGG orthology group: K00285, D-amino-acid dehydrogenase [EC: 1.4.99.1] (inferred from 79% identity to avn:Avin_47980)

MetaCyc: 63% identical to D-amino acid dehydrogenase (Escherichia coli K-12 substr. MG1655)
RXN-11193 [EC: 1.4.5.1]; 1.4.5.- [EC: 1.4.5.1]

Predicted SEED Role

"D-amino acid dehydrogenase small subunit (EC 1.4.99.1)" in subsystem Pyruvate Alanine Serine Interconversions or Respiratory dehydrogenases 1 (EC 1.4.99.1)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.4.5.1 or 1.4.99.1

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (426 amino acids)

>LRK53_RS09560 D-amino acid dehydrogenase (Rhodanobacter sp000427505 FW510-R12)
MRVLILGSGVIGTCSAWYLARAGFEVTVVDRESAPARETSFANAGQISPGYASPWAAPGV
PLKALKWLFMRHAPLAIRPGLDPQQYLWLLQMLRNCTASRYAINKARMVRLSEYSRDCMD
ELRAETGLDYEGRQLGTVQLFRTQAQLDDAAKDIAVLKQYGVPYELLDRAGIVRVEPALA
GVVDQLSGALRLPNDQTGDCELFTRLLAARAQEMGVEFRFGATVEKLEHDGGRLSGVRID
GKLERADRYVLALGSYSTQLLAPLGIRLPVYPLKGYSLTLPITDPALAPTSTILDETYKV
AVTRFDQRIRVGGMAEVSGFDLSLSPRRRATLEKVVGDLYPHGGDLSHSTFWTGLRPATP
DGTPVVGATRLDNLYLNTGHGTLGWTMACGSGRYLADLIAGRKPQISSEGLDISRYSSRS
AAGAHA