Protein Info for LRK53_RS09450 in Rhodanobacter sp000427505 FW510-R12

Annotation: alkyl hydroperoxide reductase subunit C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 187 TIGR03137: peroxiredoxin" amino acids 1 to 187 (187 residues), 343.8 bits, see alignment E=1.2e-107 PF00578: AhpC-TSA" amino acids 6 to 132 (127 residues), 123.3 bits, see alignment E=8.5e-40 PF08534: Redoxin" amino acids 19 to 135 (117 residues), 46.4 bits, see alignment E=5.5e-16 PF10417: 1-cysPrx_C" amino acids 154 to 182 (29 residues), 34 bits, see alignment 3.4e-12

Best Hits

Swiss-Prot: 72% identical to AHPC_SALTI: Alkyl hydroperoxide reductase C (ahpC) from Salmonella typhi

KEGG orthology group: K03386, peroxiredoxin (alkyl hydroperoxide reductase subunit C) [EC: 1.11.1.15] (inferred from 87% identity to rru:Rru_A1418)

MetaCyc: 71% identical to alkyl hydroperoxide reductase, AhpC component (Escherichia coli K-12 substr. MG1655)
R4-RXN [EC: 1.11.1.26]

Predicted SEED Role

"Alkyl hydroperoxide reductase protein C (EC 1.6.4.-)" in subsystem Thioredoxin-disulfide reductase (EC 1.6.4.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.11.1.15, 1.6.4.-

Use Curated BLAST to search for 1.11.1.15 or 1.11.1.26 or 1.6.4.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (187 amino acids)

>LRK53_RS09450 alkyl hydroperoxide reductase subunit C (Rhodanobacter sp000427505 FW510-R12)
MSLINTEVKPFKAQALKAGKFIEVTDANLKGKWSVVFFYPADFTFVCPTELEDLADNYAE
FQKLGVEIYSVSTDTHFAHKAWHDTSDAVKKIQYTMVGDPTHQLSRNFDVLIEADGIADR
GAFVIDPAGKIQIVEITAGGIGRDAKELLRKVKAAQYVASHPGEVCPAKWKEGEKTLAPS
LDLVGKI