Protein Info for LRK53_RS09240 in Rhodanobacter sp000427505 FW510-R12

Annotation: DUF4386 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 231 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 46 to 66 (21 residues), see Phobius details amino acids 78 to 97 (20 residues), see Phobius details amino acids 134 to 154 (21 residues), see Phobius details amino acids 162 to 184 (23 residues), see Phobius details amino acids 192 to 212 (21 residues), see Phobius details PF14329: DUF4386" amino acids 1 to 213 (213 residues), 111.2 bits, see alignment E=3.3e-36

Best Hits

KEGG orthology group: None (inferred from 34% identity to gob:Gobs_1686)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (231 amino acids)

>LRK53_RS09240 DUF4386 domain-containing protein (Rhodanobacter sp000427505 FW510-R12)
MAGLLYLLVVLIAPYRLIYVPNALFVSGDAAATIARITMHETLFRIGLATDLVCGALMAF
VALALYRLLGDVGRRHGIAMLLLGGALVPALYFFNVINDAAALLLAHGGNALAAFDPPQR
AALAMLFLRLHGEAVGAAELLWGLWLFPLAMLVLRSGFLPRLFGYGLILNGLAYLIQSIA
WAVLPGWRDMLSSMLGPLQFVEVLFMLWLLLLGARPGFRQAQAASVTPTRA