Protein Info for LRK53_RS09230 in Rhodanobacter sp000427505 FW510-R12

Annotation: class II fumarate hydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00206: Lyase_1
  • amino acids 12 to 335 (324 residues), 340.1 bits, E=1.5e-105
• PF10415: FumaraseC_C
  • amino acids 401 to 453 (53 residues), 63.4 bits, 2.2e-21

Best Hits

Swiss-Prot: 68% identical to FUMC_XYLFT: Fumarate hydratase class II (fumC) from Xylella fastidiosa (strain Temecula1 / ATCC 700964)

KEGG orthology group: K01679, fumarate hydratase, class II [EC: 4.2.1.2] (inferred from 71% identity to smt:Smal_2626)

MetaCyc: 53% identical to fumarase (Mycobacterium tuberculosis H37Rv)
Fumarate hydratase. [EC: 4.2.1.2]

Predicted SEED Role

"Fumarate hydratase class II (EC 4.2.1.2)" in subsystem TCA Cycle (EC 4.2.1.2)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• TCA cycle III (animals) (9/10 steps found)
• TCA cycle II (plants and fungi) (8/9 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• mixed acid fermentation (13/16 steps found)
• superpathway of glyoxylate bypass and TCA (10/12 steps found)
• partial TCA cycle (obligate autotrophs) (7/8 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• TCA cycle I (prokaryotic) (8/10 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (13/17 steps found)
• TCA cycle VIII (Chlamydia) (5/6 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (7/9 steps found)
• TCA cycle VII (acetate-producers) (7/9 steps found)
• TCA cycle VI (Helicobacter) (6/9 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (6/10 steps found)
• reductive TCA cycle I (6/11 steps found)
• incomplete reductive TCA cycle (3/7 steps found)
• pyruvate fermentation to propanoate I (3/7 steps found)
• methylaspartate cycle (11/19 steps found)
• reductive TCA cycle II (5/12 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (5/13 steps found)
• L-glutamate degradation VIII (to propanoate) (3/11 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (25/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.2

Use Curated BLAST to search for 4.2.1.2

Protein Sequence (461 amino acids)

>LRK53_RS09230 class II fumarate hydratase (Rhodanobacter sp000427505 FW510-R12)
MSNFRIEHDSMGELKVPADALYGAQTQRAIDNFPISGLHLPRPFIRALGLIKAAAAEVNL
AMGHLKKNQAAAIRKAALAVADGQHDAQFPIDIFQTGSGTSTNMNANEVIAHLAVAAGAK
VHPNDHVNYGQSSNDVIPTAIHVSATLTTSEQLLPALKHLKQTIDRRARELRNTPKTGRT
HLMDAMPITFGQELSGWSAQVGSAIERIGDALKRMRRLPQGGTAVGTGINADPKFGPAMA
VQLKKLTGVRFESAQNYFEGMAAQDAAVELSGALKTLAVALMKIANDLRWMNSGPLAGLG
EIELPALQPGSSIMPGKVNPVIPEATAMVAAQVIGNDASITIAGQSGNFQLNVMLPLIAH
NLLQSIGILANVSVLLADKSIAGFKVNRARVNQALAMNPILVTALNPVIGYEKGAATAKL
AYKQHRPIMEVALETTGLSKDELRKLLDPMMLTKGGIHDGG