Protein Info for LRK53_RS09190 in Rhodanobacter sp000427505 FW510-R12

Annotation: phosphoadenylyl-sulfate reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 TIGR02057: phosphoadenosine phosphosulfate reductase" amino acids 2 to 222 (221 residues), 272.5 bits, see alignment E=3.3e-85 TIGR00434: phosophoadenylyl-sulfate reductase" amino acids 13 to 222 (210 residues), 260.1 bits, see alignment E=1.9e-81 PF01507: PAPS_reduct" amino acids 28 to 199 (172 residues), 185.1 bits, see alignment E=6e-59

Best Hits

Swiss-Prot: 70% identical to CYSH_XANCB: Phosphoadenosine phosphosulfate reductase (cysH) from Xanthomonas campestris pv. campestris (strain B100)

KEGG orthology group: K00390, phosphoadenosine phosphosulfate reductase [EC: 1.8.4.8] (inferred from 70% identity to xcb:XC_0990)

MetaCyc: 65% identical to phosphoadenosine phosphosulfate reductase (Escherichia coli K-12 substr. MG1655)
Phosphoadenylyl-sulfate reductase (thioredoxin). [EC: 1.8.4.8]

Predicted SEED Role

"Phosphoadenylyl-sulfate reductase [thioredoxin] (EC 1.8.4.8)" in subsystem Cysteine Biosynthesis (EC 1.8.4.8)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.4.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>LRK53_RS09190 phosphoadenylyl-sulfate reductase (Rhodanobacter sp000427505 FW510-R12)
MAELNAMLSRFSAERRVAWALEHVAGEHVLSSSFGAQSAVSLHLVTRQRPDIPVVLIDTG
YLFPETYRFVDELTERLALNLKVYSAAFSPAWMEARHGRLWEQGVAGLDQYNRLRKVEPM
QRALAELHAVGWFAGLRRGQSRSRAAIAFAEHRQDHWKFYPLADWSDRDIGQYLARHGLP
YHPLWQQGYVSIGDSHTTRRWEPGMDAEDTRFFGLKRECGLHSIA