Protein Info for LRK53_RS09130 in Rhodanobacter sp000427505 FW510-R12

Annotation: DnaJ domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 297 PF00226: DnaJ" amino acids 5 to 66 (62 residues), 95.6 bits, see alignment E=1.5e-31 PF01556: DnaJ_C" amino acids 127 to 272 (146 residues), 131.4 bits, see alignment E=3.1e-42

Best Hits

Swiss-Prot: 49% identical to CBPA_PSEPW: Curved DNA-binding protein (cbpA) from Pseudomonas putida (strain W619)

KEGG orthology group: K05516, curved DNA-binding protein (inferred from 53% identity to smt:Smal_3019)

Predicted SEED Role

"DnaJ-class molecular chaperone CbpA" in subsystem Protein chaperones

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (297 amino acids)

>LRK53_RS09130 DnaJ domain-containing protein (Rhodanobacter sp000427505 FW510-R12)
MEFKDYYDILGVKPEASEAEIKAAYRKLARKYHPDKNKEAGAEEKFKAVNEANEVLKDTE
KRRSYDQLRAGGYRQGEQFRPPPGWQGQQGFGGGDSDFSDFFESLFGRGAAGSHHGQPRS
RRGRDVQASVQIDLQTAFDGGRTRLAMQDQAGGERVLEVKISAGIQPGQVIRLSGQGHPG
TAGGPNGDLLLEVGIRDDARFRLDGRNVVHVLPIAPWEAALGATVPVPTLAGTVDLRIPA
GSQSGRKLRLKGRGMPGANPGDQLVELSIRAPAAESDKQRAAYEALHEAFANFDPRH