Protein Info for LRK53_RS09065 in Rhodanobacter sp000427505 FW510-R12

Annotation: transcription termination factor NusA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 501 PF08529: NusA_N" amino acids 4 to 128 (125 residues), 129.9 bits, see alignment E=1.5e-41 TIGR01953: transcription termination factor NusA" amino acids 5 to 347 (343 residues), 416 bits, see alignment E=1e-128 PF00575: S1" amino acids 137 to 199 (63 residues), 30.8 bits, see alignment E=7.8e-11 PF13184: KH_NusA_1st" amino acids 203 to 280 (78 residues), 105 bits, see alignment E=4.9e-34 PF26594: KH_NusA_2nd" amino acids 285 to 348 (64 residues), 82.8 bits, see alignment E=3e-27 TIGR01954: transcription termination factor NusA, C-terminal duplication" amino acids 369 to 418 (50 residues), 70.1 bits, see alignment 1.2e-23 amino acids 444 to 491 (48 residues), 62.7 bits, see alignment 2.5e-21 PF14520: HHH_5" amino acids 436 to 490 (55 residues), 39.8 bits, see alignment 1.3e-13

Best Hits

Swiss-Prot: 58% identical to NUSA_SHIFL: Transcription termination/antitermination protein NusA (nusA) from Shigella flexneri

KEGG orthology group: K02600, N utilization substance protein A (inferred from 81% identity to psu:Psesu_1830)

Predicted SEED Role

"Transcription termination protein NusA" in subsystem NusA-TFII Cluster or Transcription factors bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (501 amino acids)

>LRK53_RS09065 transcription termination factor NusA (Rhodanobacter sp000427505 FW510-R12)
MSKELLLVVDAVANEKGVPLEVIFEAMEAALASAAKKRYPDEEPDIRVSIDHNTGEYETF
RRWEIIADDGEMESPSYQLRLMDALDERADAKVGEYIEQQIENAEFGRIAAQAAKQVIVQ
RVREAERQQVVDAFADRVGELVTGIVKRVERGNIYLDLGSNAEAFIPRDKTIPRESARVG
DRVRGYLYEVRSEARGPQLFVSRAAPEFMIELFKLEVPEVGQGLVEIKGCARDPGDRAKI
AVLAHDSRTDPIGACIGMRGSRVQAVSNDLNGERVDIILWHENQAQYVINAMAPAEVQSI
IMDEEKHSMDIAVAEDKLSQAIGRGGQNVRLASKLTGWQLNVMTQDQVTAKSESEQEAAR
QLFMDKLEVDQEIAVILVQEGFSSIEEIAYVPSAELLAVEGFDEDIVEELRARARDALLT
EALAVEEGVGEHQPSEELLALDGMDEETAFALAARAVTTVDDLADLAVDDLIDIEGMDEE
RAAALIMAARAPMIARLEKGG