Protein Info for LRK53_RS08970 in Rhodanobacter sp000427505 FW510-R12

Annotation: NADH-quinone oxidoreductase subunit NuoH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 transmembrane" amino acids 12 to 33 (22 residues), see Phobius details amino acids 79 to 101 (23 residues), see Phobius details amino acids 113 to 134 (22 residues), see Phobius details amino acids 154 to 174 (21 residues), see Phobius details amino acids 190 to 208 (19 residues), see Phobius details amino acids 237 to 264 (28 residues), see Phobius details amino acids 279 to 303 (25 residues), see Phobius details amino acids 323 to 342 (20 residues), see Phobius details PF00146: NADHdh" amino acids 16 to 335 (320 residues), 408.4 bits, see alignment E=9.9e-127

Best Hits

Swiss-Prot: 65% identical to NUOH_XANC5: NADH-quinone oxidoreductase subunit H (nuoH) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K00337, NADH dehydrogenase I subunit H [EC: 1.6.5.3] (inferred from 66% identity to psu:Psesu_1838)

Predicted SEED Role

"NADH-ubiquinone oxidoreductase chain H (EC 1.6.5.3)" in subsystem Respiratory Complex I (EC 1.6.5.3)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.5.3

Use Curated BLAST to search for 1.6.5.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (350 amino acids)

>LRK53_RS08970 NADH-quinone oxidoreductase subunit NuoH (Rhodanobacter sp000427505 FW510-R12)
MADQLINQVVWPLIYILCIVLPLVIAVAMFVYWERKVIGWMHVRLGPNKIGPGGVLQAFA
DVVKLLIKEVILPTKASRFLYFLAPLIGLVPALAAWAVIPFSGKMVLSNANAGILYLLAM
TSMGVYGIIIAGWASNSRYALLGAMRSAAQVISYELAMGLCLVCVMVLAGSLNLSEIVNA
QAGGKGLFDWFWLPLLPVFVIYFVSGVAETNRLPFDMAEGESEIVAGFHVEYSGSAFALF
FLAEYANMILVSFLSATFFLGGWLSPLQGWISADAPGWISWLGAGSFAWLFIKAFVMSFF
FLWFRATFPRYRYDQIMRLGWKVFIPIGIAWVFVAGLLKYYGLVSTGVGA