Protein Info for LRK53_RS08875 in Rhodanobacter sp000427505 FW510-R12

Annotation: ketoacyl-ACP synthase III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 324 TIGR00747: 3-oxoacyl-[acyl-carrier-protein] synthase III" amino acids 5 to 323 (319 residues), 438.4 bits, see alignment E=7.5e-136 PF00108: Thiolase_N" amino acids 39 to 147 (109 residues), 27.3 bits, see alignment E=3.5e-10 PF08545: ACP_syn_III" amino acids 109 to 186 (78 residues), 108.9 bits, see alignment E=1.4e-35 PF08541: ACP_syn_III_C" amino acids 235 to 324 (90 residues), 119.9 bits, see alignment E=6.5e-39

Best Hits

Swiss-Prot: 71% identical to FABH_XANCP: 3-oxoacyl-[acyl-carrier-protein] synthase 3 (fabH) from Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25)

KEGG orthology group: K00648, 3-oxoacyl-[acyl-carrier-protein] synthase III [EC: 2.3.1.180] (inferred from 74% identity to sml:Smlt1026)

MetaCyc: 36% identical to 3-oxoacyl-(acyl-carrier-protein) synthase III (Agrobacterium fabrum C58)
RXN-22027

Predicted SEED Role

"3-oxoacyl-[acyl-carrier-protein] synthase, KASIII (EC 2.3.1.180)" (EC 2.3.1.180)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.3.1.180

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (324 amino acids)

>LRK53_RS08875 ketoacyl-ACP synthase III (Rhodanobacter sp000427505 FW510-R12)
MAQIYSRIIATGSALPERVVTNADLEKIVDTSDEWIRTRTGIRQRHIAADGETTGDLAFR
AAQNALEAAGVRASELDLIVLGTTTPDIIFPSTACLVQDRLGANGCAAFDVNAACSGFMY
ALGIADKFIRSGQSKKALVIGAETLTRMVDWGERETCVLFGDGAGAVVLEAASEPGVYAT
CLHADGGYKELLWNPVGVSAGFKDEPNHGVRIRMAGREVFKVAVKTLDSLVGETLHAAGM
DESQVDWLIPHQANLRIIEATAKRLNMSMERVIVTVDKHANTSSGSVPLALDYAVRSGKV
QRGQNLLLEAFGGGFTWASALLRY