Protein Info for LRK53_RS08840 in Rhodanobacter sp000427505 FW510-R12

Annotation: DUF3488 and transglutaminase-like domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 660 transmembrane" amino acids 14 to 31 (18 residues), see Phobius details amino acids 37 to 54 (18 residues), see Phobius details amino acids 66 to 84 (19 residues), see Phobius details amino acids 90 to 106 (17 residues), see Phobius details amino acids 113 to 130 (18 residues), see Phobius details amino acids 135 to 155 (21 residues), see Phobius details amino acids 167 to 189 (23 residues), see Phobius details amino acids 549 to 571 (23 residues), see Phobius details PF11992: TgpA_N" amino acids 21 to 337 (317 residues), 226.3 bits, see alignment E=7.8e-71 PF01841: Transglut_core" amino acids 383 to 478 (96 residues), 83.1 bits, see alignment E=2.6e-27 PF13559: DUF4129" amino acids 582 to 651 (70 residues), 49.6 bits, see alignment E=5.2e-17

Best Hits

Predicted SEED Role

"FIG001454: Transglutaminase-like enzymes, putative cysteine proteases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (660 amino acids)

>LRK53_RS08840 DUF3488 and transglutaminase-like domain-containing protein (Rhodanobacter sp000427505 FW510-R12)
MTPRRPRPPSERPIDTRAFDLLSLTMALVLGLHAPHLPWWLAIALALILGWRWWQRRRHA
GRVPRWLKLPLLALLTLAVIVQYGNIFGRAPGAALAVGLLILKLLETEVARDVRVGISFA
CFALMVALLFDQGLVTTVVVALSLLPALATLGALEPGQLPAPSLPRALLPALALTAAALP
LALLAFLLVPRLSSPLWGAPAQDQARTGLSDSMTPGNFTDLLTDDHPAMRVSFDGAPPAP
DQRYFRAYVMWHFDGRSWRRLDPRYAPPRQPAPLEVASSVPYRISLQPTWRRMLPMLDVP
LQAPAQATLQADREVMADKPVNDPLDYVGRSALRYRLQPELDERSRRLGLSLPADFNPRT
HALAAQWRQRYGSDDAAIVQAALALFHDGGFRYTLAPAPLGRDSVDDFLFDTHEGFCEHY
SSAFTVLMRAAGIPARVVTGYQGGYWNKLGDYLLVRYSDAHAWSEVWLAGRGWVRVDPTG
AVRPERVSLGAAAAAGGQLAWYRHDWLQGLRNRWDIVNRWWDQGVIGFDALRQRGLLTPF
GIRDADTATLGVLLAIGGVLFIAIGLAWALLRRQPRDPLRDALRELERKLARHGIARRPA
EGPQHYLSRAARALPGQREELASLMRSYLELRYAHDEPPTEPLRAFQHAVRDFRIVDVVK