Protein Info for LRK53_RS08625 in Rhodanobacter sp000427505 FW510-R12

Annotation: DUF3772 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 750 803 signal peptide" amino acids 1 to 22 (22 residues), see Phobius details transmembrane" amino acids 211 to 230 (20 residues), see Phobius details amino acids 251 to 272 (22 residues), see Phobius details amino acids 286 to 310 (25 residues), see Phobius details amino acids 330 to 347 (18 residues), see Phobius details amino acids 362 to 381 (20 residues), see Phobius details amino acids 402 to 457 (56 residues), see Phobius details amino acids 487 to 510 (24 residues), see Phobius details amino acids 535 to 557 (23 residues), see Phobius details amino acids 578 to 600 (23 residues), see Phobius details amino acids 606 to 632 (27 residues), see Phobius details PF12607: DUF3772" amino acids 133 to 194 (62 residues), 52.9 bits, see alignment 2.4e-18 PF00924: MS_channel_2nd" amino acids 624 to 690 (67 residues), 73.5 bits, see alignment E=1.2e-24

Best Hits

KEGG orthology group: None (inferred from 44% identity to dia:Dtpsy_0786)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (803 amino acids)

>LRK53_RS08625 DUF3772 domain-containing protein (Rhodanobacter sp000427505 FW510-R12)
MPNLLRFLLLLLLTLGSAASPAQDNDQSPPTTAPAATPAPTLDQLGSQLDTVKAALKDNK
SDTPLADLRNIALGVQDQARQLATNLAPQMTALQAQLAVLGPVPAKGAPAEAPEVATQRR
KLDKAQADLDAQIKQAQLLGQNATQLAAQINGLRNDEFQARLASRTATPFSRTFWADPVR
AFPDDMVRFKRLGARFAGAMAQAWQPPNRQPLMWCLVTAALLLVGGRRLLEWLLLLLAAR
HVPDGHLRRSAMATAVALSAVLTTGLAAQLAYQGLNWNGILDNDLAALATSVVGLVYFAA
YVTGLGRALLSVRRPSWRLPALSDLAAQRLHLFPWLLAAAALLFGLLDRTSRAIGTSLPA
SVATRGLFALVISGLIGLALLRLRRARRAAAAEGAEPEHRPLWIGLLGAAAALGVAVSWL
GVATGFIALAFFVAVQMLWVGVIVATVYLLIQLLTDLIDTLLLPHGRSGRRLQATFELAP
HTLEQTAVLLTGIGRVGLVLLALATVLTPFGAGPKDLLASAEQTLGSVKLGELAINPGTI
FGGVLVLVVGMFVLRMLKRWLAEQLLPKSTMEKGMQDSIVTLLGYVGGLLVAVLTLAALH
VDLKSITWIVSALSVGIGFGLQAIVQNFISGLILLVERPVKVGDWVSLSSDVEGDIRRIN
VRATEIQMGDRSTVIVPNSQLITQNVRNVTLANAQGRVQIKLPMPLDTDAGKVRELVLGI
LRAHHGTLAAPAPYVQLESVATGVMTFNCVAYVSGPREAGSVKSELLFEILERLRRERLP
MTSPQSMLVRTLPPLPEDDEHTG