Protein Info for LRK53_RS08460 in Rhodanobacter sp000427505 FW510-R12

Annotation: histidinol dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 432 PF00815: Histidinol_dh" amino acids 23 to 428 (406 residues), 541.7 bits, see alignment E=6.3e-167 TIGR00069: histidinol dehydrogenase" amino acids 33 to 427 (395 residues), 522.4 bits, see alignment E=4.6e-161

Best Hits

Swiss-Prot: 65% identical to HISX_XANC5: Histidinol dehydrogenase (hisD) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K00013, histidinol dehydrogenase [EC: 1.1.1.23] (inferred from 66% identity to xal:XALc_1254)

MetaCyc: 59% identical to histidinal/histidinol dehydrogenase (Escherichia coli K-12 substr. MG1655)
Histidinol dehydrogenase. [EC: 1.1.1.23]

Predicted SEED Role

"Histidinol dehydrogenase (EC 1.1.1.23)" in subsystem Histidine Biosynthesis (EC 1.1.1.23)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (432 amino acids)

>LRK53_RS08460 histidinol dehydrogenase (Rhodanobacter sp000427505 FW510-R12)
MKRLDWNALDETARREALARPAQSRVDELRRGVEQIIATVREGGDTALRELSAKYDRCEL
QAIAVDETEFAAAEASLDPALKAAIREAAARIEAFHRAAALQPVAVDTAPGVRVERMLRP
IGRVGLYVPAGSAPLPSTALMLGVPAHIAGCREVVLCSPARADGRCDEAVLYAARLTGVH
KVFKLGGAQAIAAMAYGTESVPKCDKLFGPGNAWVTEAKLQVSSDPDGAAIDMPAGPSEV
LVIADAGANPVFVAADLLSQAEHGPDSQVILLSPSAALLDRVAAEVERQCAELPRAAIAA
QALAQSRLIAVDSLAQAVEVSNRYAPEHLILQVAAPRALLDGVESAGSIFLGQWAPESVG
DYCSGSNHVLPTYGYARSYSGVSVASYQKQISVQEVSADGLRNIGPCTATLAAAEQLEAH
RRAVTLRLEALA