Protein Info for LRK53_RS08405 in Rhodanobacter sp000427505 FW510-R12

Annotation: response regulator transcription factor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 225 PF00072: Response_reg" amino acids 4 to 114 (111 residues), 72.5 bits, see alignment E=3.1e-24 PF00486: Trans_reg_C" amino acids 148 to 222 (75 residues), 91.7 bits, see alignment E=2.4e-30

Best Hits

Swiss-Prot: 47% identical to CZCR_CUPMC: Transcriptional activator protein CzcR (czcR) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)

KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 59% identity to hna:Hneap_0785)

Predicted SEED Role

"response regulator in two-component regulatory system with PhoQ" in subsystem Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (225 amino acids)

>LRK53_RS08405 response regulator transcription factor (Rhodanobacter sp000427505 FW510-R12)
MRCLLIEDDLATAELVRHGLERAGHVVQACHEGDTGLRLALDGSWDVLVLDRMLPGGVDG
LGVLAALRSHGIATPVIVLSALSSLDERVRGLRSGGDDYLGKPFAFDELLARIEALARRA
VQRSEPDVIEIGDLRVDTRNRRVHRGTQAITLQPREYQLLEYLARHQGMVVTRRMLLTAV
WGYHFDPETNVIDVQISRLRNKLDRDFPTPLIHTARGVGYTLRAE