Protein Info for LRK53_RS08405 in Rhodanobacter sp000427505 FW510-R12
Annotation: response regulator transcription factor
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 47% identical to CZCR_CUPMC: Transcriptional activator protein CzcR (czcR) from Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34)
KEGG orthology group: K02483, two-component system, OmpR family, response regulator (inferred from 59% identity to hna:Hneap_0785)Predicted SEED Role
"response regulator in two-component regulatory system with PhoQ" in subsystem Phosphate metabolism
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
Find the best match in UniProt
Protein Sequence (225 amino acids)
>LRK53_RS08405 response regulator transcription factor (Rhodanobacter sp000427505 FW510-R12) MRCLLIEDDLATAELVRHGLERAGHVVQACHEGDTGLRLALDGSWDVLVLDRMLPGGVDG LGVLAALRSHGIATPVIVLSALSSLDERVRGLRSGGDDYLGKPFAFDELLARIEALARRA VQRSEPDVIEIGDLRVDTRNRRVHRGTQAITLQPREYQLLEYLARHQGMVVTRRMLLTAV WGYHFDPETNVIDVQISRLRNKLDRDFPTPLIHTARGVGYTLRAE