Protein Info for LRK53_RS08355 in Rhodanobacter sp000427505 FW510-R12

Annotation: tryptophan synthase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 PF00290: Trp_syntA" amino acids 8 to 244 (237 residues), 267.1 bits, see alignment E=5.7e-84 TIGR00262: tryptophan synthase, alpha subunit" amino acids 8 to 250 (243 residues), 222.6 bits, see alignment E=2e-70

Best Hits

Swiss-Prot: 61% identical to TRPA_XYLFA: Tryptophan synthase alpha chain (trpA) from Xylella fastidiosa (strain 9a5c)

KEGG orthology group: K01695, tryptophan synthase alpha chain [EC: 4.2.1.20] (inferred from 62% identity to psu:Psesu_1934)

Predicted SEED Role

"Tryptophan synthase alpha chain (EC 4.2.1.20)" in subsystem Auxin biosynthesis or Tryptophan synthesis (EC 4.2.1.20)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.20

Use Curated BLAST to search for 4.2.1.20

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>LRK53_RS08355 tryptophan synthase subunit alpha (Rhodanobacter sp000427505 FW510-R12)
MSRIDRRFAALKAANRTGLIPFVTAGDPSPQHMVALMHALVDVGADLIELGVPFSDPMAD
GPVIQHASERAIAKGVGLADVLGWVARFRQRDADTPIVLMGYLNPVEIHGYARFAQEAVQ
AGVDGVLLVDCPLEESAVLQPLRDAGLQQILLAAPTTEPSRMAQLCGSAEGFLYYVSFAG
ITGAAHLSTGDIAVRVADIRARAKAPVAVGFGIRDAASAQAIAGFADAVVIGSALVDKLA
GATDADDIAGRVRAFLAPIRSALDAH