Protein Info for LRK53_RS08205 in Rhodanobacter sp000427505 FW510-R12

Annotation: RnfABCDGE type electron transport complex subunit B

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 TIGR01944: electron transport complex, RnfABCDGE type, B subunit" amino acids 4 to 147 (144 residues), 211.7 bits, see alignment E=3.5e-67 PF04060: FeS" amino acids 12 to 44 (33 residues), 56.8 bits, see alignment 5.1e-19 PF14697: Fer4_21" amino acids 77 to 130 (54 residues), 62.6 bits, see alignment E=1.1e-20 PF13237: Fer4_10" amino acids 79 to 125 (47 residues), 28.9 bits, see alignment 3e-10 PF00037: Fer4" amino acids 79 to 99 (21 residues), 25.1 bits, see alignment (E = 4e-09) amino acids 109 to 129 (21 residues), 25.7 bits, see alignment (E = 2.7e-09) PF13187: Fer4_9" amino acids 83 to 129 (47 residues), 28.4 bits, see alignment 5e-10 PF12838: Fer4_7" amino acids 84 to 128 (45 residues), 29.6 bits, see alignment 2.7e-10

Best Hits

KEGG orthology group: K03616, electron transport complex protein RnfB (inferred from 57% identity to bbr:BB3784)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (200 amino acids)

>LRK53_RS08205 RnfABCDGE type electron transport complex subunit B (Rhodanobacter sp000427505 FW510-R12)
MTDLADRIDALLPQTQCEQCGYHGCRPYAEAIARGEAAINRCPPGGTAGIAKLAALLERP
MLPLDRACGVEKPRMLARIVEADCIGCTKCTQACPVDAIVGASKLMHTVLADDCTGCELC
VPACPVDCIVLEPMPMEQIDQTHADAARGHFQRREARLAREATEREAELAMRKTAVDTAA
SSNPVLAALARARAKQDKSS