Protein Info for LRK53_RS08115 in Rhodanobacter sp000427505 FW510-R12

Annotation: histidine utilization repressor

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 241 TIGR02018: histidine utilization repressor" amino acids 6 to 233 (228 residues), 276.6 bits, see alignment E=6.9e-87 PF00392: GntR" amino acids 8 to 70 (63 residues), 67.3 bits, see alignment E=1.9e-22 PF13412: HTH_24" amino acids 34 to 60 (27 residues), 24 bits, see alignment (E = 6e-09) PF08220: HTH_DeoR" amino acids 34 to 66 (33 residues), 21.8 bits, see alignment 3.2e-08 PF07702: UTRA" amino acids 91 to 228 (138 residues), 107.4 bits, see alignment E=1.4e-34

Best Hits

Swiss-Prot: 46% identical to HUTC_KLEAE: Histidine utilization repressor (hutC) from Klebsiella aerogenes

KEGG orthology group: K05836, GntR family transcriptional regulator, histidine utilization repressor (inferred from 45% identity to xne:XNC1_3188)

Predicted SEED Role

"Histidine utilization repressor" in subsystem Histidine Degradation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (241 amino acids)

>LRK53_RS08115 histidine utilization repressor (Rhodanobacter sp000427505 FW510-R12)
MNGRQPQYLKLKRHILRHITNGDWPPLSKVPSENELASRFGISRMTVNRAMRELTDAGML
TRTQGAGTFVAERKAESAMFEVRSIRNEIVSRGQAHTVEILTRELVSARPVTARQFALPA
GTKLYHSRLLHRADGEPLQLEDRFVNPVCAPDYLEIDFYKEIPHQYLMRTAPLQRIEHVI
EAEAASKRLARLLDVEPGSPLLTLTRRTWSRDQIASYVRLSYPAGKFRFVGDFNVGDFKT
P