Protein Info for LRK53_RS07975 in Rhodanobacter sp000427505 FW510-R12

Annotation: acyl-CoA dehydrogenase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 PF02771: Acyl-CoA_dh_N" amino acids 18 to 130 (113 residues), 127.6 bits, see alignment E=6e-41 PF02770: Acyl-CoA_dh_M" amino acids 134 to 224 (91 residues), 87.9 bits, see alignment E=8.5e-29 PF00441: Acyl-CoA_dh_1" amino acids 237 to 383 (147 residues), 114.9 bits, see alignment E=7.3e-37 PF08028: Acyl-CoA_dh_2" amino acids 257 to 358 (102 residues), 45.3 bits, see alignment E=2.1e-15

Best Hits

Swiss-Prot: 48% identical to GCDH_DICDI: Glutaryl-CoA dehydrogenase, mitochondrial (gcdh) from Dictyostelium discoideum

KEGG orthology group: K00252, glutaryl-CoA dehydrogenase [EC: 1.3.99.7] (inferred from 84% identity to psu:Psesu_1745)

MetaCyc: 53% identical to glutaryl-CoA dehydrogenase (Pseudomonas putida KT2440)
GLUTARYL-COA-DEHYDROGENASE-RXN [EC: 1.3.8.6]

Predicted SEED Role

"Glutaryl-CoA dehydrogenase (EC 1.3.99.7)" (EC 1.3.99.7)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.3.8.6 or 1.3.99.7

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (389 amino acids)

>LRK53_RS07975 acyl-CoA dehydrogenase family protein (Rhodanobacter sp000427505 FW510-R12)
MAVRLNPLDLYDVRSLLTDEERMVQDTVGRFVDERVLPIIGDCFDQGRFPKELVPEIAGL
GLLGATIPEKYGCAGMSGVSYGLICQELERGDSGLRSFASVQSSLCMYPIYAYGSEEQKL
HYLPKMAAGEVIGCFGLTEPHGGSDPANMKTHAKQDGADWIINGAKMWITNGNLAHIAIV
WAQTGDGIQGFIVPTDSAGFKAQEIHKKMSLRASVTSALFFDNVRVPDSARLPNVKGLKG
PLGCLTQARYGITWGPIGAAQACLREVLDYTAERILFGRPLASNQAIQLKLADMARRITT
AQLLSLQLGRLKDAGKMQPTQVSLAKWNNCRMAIDIARQCRDILGGAGITTEHSAIRHAL
NLESVITYEGTETVHELVVGRELTGINAF