Protein Info for LRK53_RS07575 in Rhodanobacter sp000427505 FW510-R12

Annotation: glutamate-5-semialdehyde dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 422 PF00171: Aldedh" amino acids 9 to 302 (294 residues), 53.5 bits, see alignment E=7.9e-19 TIGR00407: glutamate-5-semialdehyde dehydrogenase" amino acids 12 to 402 (391 residues), 443.5 bits, see alignment E=3.1e-137

Best Hits

Swiss-Prot: 74% identical to PROA_XANOP: Gamma-glutamyl phosphate reductase (proA) from Xanthomonas oryzae pv. oryzae (strain PXO99A)

KEGG orthology group: K00147, glutamate-5-semialdehyde dehydrogenase [EC: 1.2.1.41] (inferred from 74% identity to xop:PXO_00342)

Predicted SEED Role

"Gamma-glutamyl phosphate reductase (EC 1.2.1.41)" in subsystem Proline Synthesis (EC 1.2.1.41)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.2.1.41

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (422 amino acids)

>LRK53_RS07575 glutamate-5-semialdehyde dehydrogenase (Rhodanobacter sp000427505 FW510-R12)
MSTIREQAQACRDAAQVVVGLDTTAKCALLRDMAAALEAQSAAVLAANAEDMRQAAAKGV
QGAMLDRLRLDEARVAGIAGALREVAELPDPVGVTTRRETRPNGLSIERVRIPLGVIAMI
YEARPNVTADAAALCLMAGNAVILRGGSEAIHSNLAIAAALHAALRVHGVPEAAVTVLDD
LSREAMVELLQLGDLVDLAIPRGGEGLIRFVAEHARVPVIKHYKGVCHLYVDRAADLELA
LGLLIDGKTSRPGVCNALETLLVHRDVAEAFLPRAAAALRERSVELRGDDPSRALVPTMH
AATDDDYAAEFLDLILAVRVVDSLDEAIAHIHRYGSDHTEVIATADEAAAQRFVRAIRSA
VVMVNASSRFSDGGELGLGAEIGISTTRLHAYGPMGAEALTVERFVVRGAGQVRHPLSRA
QC