Protein Info for LRK53_RS07480 in Rhodanobacter sp000427505 FW510-R12

Annotation: bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR01983: 3-demethylubiquinone-9 3-O-methyltransferase
  • amino acids 10 to 227 (218 residues), 261.4 bits, E=2.9e-82
• PF01209: Ubie_methyltran
  • amino acids 46 to 154 (109 residues), 31.3 bits, E=6.6e-11
• PF06325: PrmA
  • amino acids 47 to 152 (106 residues), 32.9 bits, E=2.6e-11
• PF05401: NodS
  • amino acids 47 to 174 (128 residues), 24.5 bits, E=1.1e-08
• PF02353: CMAS
  • amino acids 50 to 155 (106 residues), 32 bits, E=4e-11
• PF13489: Methyltransf_23
  • amino acids 50 to 202 (153 residues), 82.6 bits, E=1.4e-26
• PF13847: Methyltransf_31
  • amino acids 50 to 154 (105 residues), 59 bits, E=2.3e-19
• PF05175: MTS
  • amino acids 51 to 150 (100 residues), 27.9 bits, E=8.7e-10
• PF13649: Methyltransf_25
  • amino acids 53 to 146 (94 residues), 71.2 bits, E=4.8e-23
• PF08242: Methyltransf_12
  • amino acids 55 to 148 (94 residues), 63 bits, E=1.8e-20
• PF08241: Methyltransf_11
  • amino acids 55 to 149 (95 residues), 81 bits, E=4.1e-26

Best Hits

Swiss-Prot: 60% identical to UBIG_XANC5: Ubiquinone biosynthesis O-methyltransferase (ubiG) from Xanthomonas campestris pv. vesicatoria (strain 85-10)

KEGG orthology group: K00568, 3-demethylubiquinone-9 3-methyltransferase [EC: 2.1.1.- 2.1.1.64] (inferred from 60% identity to xcv:XCV2574)

MetaCyc: 62% identical to bifunctional 3-demethylubiquinol 3-O-methyltransferase/polyprenyldihydroxybenzoate methyltransferase (Xanthomonas campestris pv. campestris)
3-demethylubiquinone-9 3-O-methyltransferase. [EC: 2.1.1.64]; Hexaprenyldihydroxybenzoate methyltransferase. [EC: 2.1.1.64, 2.1.1.114]

Predicted SEED Role

"3-demethylubiquinone-9 3-methyltransferase (EC 2.1.1.64)" in subsystem Ubiquinone Biosynthesis (EC 2.1.1.64)

MetaCyc Pathways

• ubiquinol-8 biosynthesis (late decarboxylation) (7/9 steps found)
• superpathway of ubiquinol-8 biosynthesis (early decarboxylation) (9/12 steps found)
• ubiquinol-8 biosynthesis (early decarboxylation) (5/8 steps found)
• ubiquinol-6 biosynthesis (late decarboxylation) (3/8 steps found)
• superpathway of chorismate metabolism (39/59 steps found)
• ubiquinol-6 biosynthesis from 4-aminobenzoate (yeast) (3/9 steps found)
• ubiquinol-10 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-7 biosynthesis (late decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (early decarboxylation) (2/8 steps found)
• ubiquinol-9 biosynthesis (late decarboxylation) (2/8 steps found)
• superpathway of ubiquinol-6 biosynthesis (late decarboxylation) (4/11 steps found)
• ubiquinol-10 biosynthesis (late decarboxylation) (2/9 steps found)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-, 2.1.1.64

Use Curated BLAST to search for 2.1.1.- or 2.1.1.114 or 2.1.1.64

Protein Sequence (242 amino acids)

>LRK53_RS07480 bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG (Rhodanobacter sp000427505 FW510-R12)
MTTANVNPAEIARFDSLAARWWDPDGESRPLHDLNPVRAAYAAARVDLCGAKVADVGCGG
GLLSEALARAGAKVTGIDLGGKVIEVAKLHLHESGLAVDYRVQSSTELAAAEPASFDAVC
CMELVEHVPDPQALVNDLAALLKPGGRLFMSTLNRTPAAFGAAIVGAEYVMRLLPRGTHH
YAQFLKPSELGRLLRHAGLELEDVSGLAYNPLSRKAWLSSITAVNYVLSARPTGTSYGRK
PA