Protein Info for LRK53_RS07420 in Rhodanobacter sp000427505 FW510-R12

Annotation: DNA repair protein RadA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 TIGR00416: DNA repair protein RadA" amino acids 1 to 457 (457 residues), 630.3 bits, see alignment E=8.7e-194 PF18073: Zn_ribbon_LapB" amino acids 8 to 35 (28 residues), 37 bits, see alignment (E = 6.4e-13) PF23442: DUF7125" amino acids 79 to 244 (166 residues), 29.4 bits, see alignment E=1.7e-10 PF13481: AAA_25" amino acids 80 to 227 (148 residues), 41 bits, see alignment E=5.1e-14 PF06745: ATPase" amino acids 81 to 162 (82 residues), 45.2 bits, see alignment E=2.4e-15 PF13401: AAA_22" amino acids 98 to 222 (125 residues), 31.7 bits, see alignment E=5.2e-11 PF13541: ChlI" amino acids 351 to 435 (85 residues), 40 bits, see alignment E=1e-13

Best Hits

Swiss-Prot: 60% identical to RADA_ECOLI: DNA repair protein RadA (radA) from Escherichia coli (strain K12)

KEGG orthology group: K04485, DNA repair protein RadA/Sms (inferred from 77% identity to xca:xccb100_3175)

Predicted SEED Role

"DNA repair protein RadA" in subsystem DNA repair, bacterial

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (461 amino acids)

>LRK53_RS07420 DNA repair protein RadA (Rhodanobacter sp000427505 FW510-R12)
MAKAKTAYVCTDCGAEHPKWQGACAECGAWNTLSEIVLAPASAAKPSVGAQRSSYAGAAA
GAPRITPLTAVALTTEARTLTGIGELDRVLGGGLVQGSVVLIGGDPGIGKSTLLLQMLGT
LGGQLPSVYVTGEESLAQVAARAQRLGLPLEPLQALAETCIERILEQAAATRPRVLVVDS
IQTIWTELLTAAPGSVSQVRESAAKLTRYAKETGTSVFLVGHVTKEGGIAGPRVLEHMVD
AVLYFEGESGSRFRVLRAFKNRFGAVNELGVFAMGDKGLREVPNPSAIFLSTHAGPTPGS
AVMVTREGTRPLLVEVQALVDQSSLGNPRRVTLGLEQNRLAMLLAVLHRHGGVAAYDQDV
FVNVVGGIRVQETAADLPVLLAVLSSLRDRPLPEHTIAFGEVGLSGEIRPVPNGEERLKE
AAHHGFRRAIVPKANAPKKGRVGEMEVVGVERLGEAIDACR