Protein Info for LRK53_RS07365 in Rhodanobacter sp000427505 FW510-R12

Annotation: carbonate dehydratase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00484: Pro_CA
  • amino acids 37 to 189 (153 residues), 171.7 bits, E=7.1e-55

Best Hits

Swiss-Prot: 48% identical to CAN_HAEIN: Carbonic anhydrase 2 (can) from Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)

KEGG orthology group: K01673, carbonic anhydrase [EC: 4.2.1.1] (inferred from 63% identity to xcv:XCV1646)

Predicted SEED Role

"Carbonic anhydrase (EC 4.2.1.1)" in subsystem Carboxysome or Cyanate hydrolysis (EC 4.2.1.1)

MetaCyc Pathways

• CO₂ fixation into oxaloacetate (anaplerotic) (2/2 steps found)
• cyanate degradation (2/3 steps found)
• C4 photosynthetic carbon assimilation cycle, NAD-ME type (7/11 steps found)
• C4 photosynthetic carbon assimilation cycle, NADP-ME type (4/7 steps found)
• 3-hydroxypropanoate cycle (8/13 steps found)
• 3-hydroxypropanoate/4-hydroxybutanate cycle (11/18 steps found)
• C4 photosynthetic carbon assimilation cycle, PEPCK type (8/14 steps found)
• glyoxylate assimilation (6/13 steps found)
• gluconeogenesis II (Methanobacterium thermoautotrophicum) (8/18 steps found)
• superpathway of the 3-hydroxypropanoate cycle (8/18 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (25/56 steps found)

KEGG Metabolic Maps

• Nitrogen metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 4.2.1.1

Protein Sequence (221 amino acids)

>LRK53_RS07365 carbonate dehydratase (Rhodanobacter sp000427505 FW510-R12)
MNSLKDLLANNRRWAAQVTAQDPTFFEQLSQQQAPRYLWIGCSDSRVPATQIVDLPPGEI
FVHRNVANVVVHTDLNALSTIQFAVDVLHVKHILVVGHYGCGGVGAVLKESRLGLIDNWL
RHITDIAMKHADKLDPAQSFAIRHARLCELNALEQALNVCHTTVVREAWERGQQLAVHAW
IYGLDDGHIHDLGLDVRSREQLPEAYHQAMTQLTRRWEGAA