Protein Info for LRK53_RS07030 in Rhodanobacter sp000427505 FW510-R12

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12704: MacB_PCD
  • amino acids 34 to 223 (190 residues), 49.3 bits, E=7.7e-17
• PF02687: FtsX
  • amino acids 259 to 371 (113 residues), 42.2 bits, E=7.9e-15

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 60% identity to xal:XALc_1771)

Predicted SEED Role

"Cysteine desulfurase (EC 2.8.1.7)" in subsystem Alanine biosynthesis (EC 2.8.1.7)

MetaCyc Pathways

• superpathway of L-alanine biosynthesis (4/4 steps found)
• superpathway of thiamine diphosphate biosynthesis II (9/11 steps found)
• L-alanine biosynthesis III (1/1 steps found)
• L-cysteine degradation IV (1/1 steps found)
• thiazole component of thiamine diphosphate biosynthesis II (5/7 steps found)
• superpathway of thiamine diphosphate biosynthesis I (7/10 steps found)
• cytidylyl molybdenum cofactor sulfurylation (1/2 steps found)
• bis(guanylyl molybdopterin) cofactor sulfurylation (1/3 steps found)
• thiazole component of thiamine diphosphate biosynthesis I (3/6 steps found)
• tRNA-uridine 2-thiolation (mammalian mitochondria) (1/4 steps found)
• tRNA-uridine 2-thiolation (yeast mitochondria) (1/4 steps found)
• molybdopterin biosynthesis (2/6 steps found)
• tRNA-uridine 2-thiolation (thermophilic bacteria) (1/5 steps found)
• tRNA-uridine 2-thiolation (cytoplasmic) (1/8 steps found)
• tRNA-uridine 2-thiolation and selenation (bacteria) (3/11 steps found)
• [2Fe-2S] iron-sulfur cluster biosynthesis (2/10 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.8.1.7

Use Curated BLAST to search for 2.8.1.7

Protein Sequence (376 amino acids)

>LRK53_RS07030 ABC transporter permease (Rhodanobacter sp000427505 FW510-R12)
MVALARKTLVYEWRRFLPAMLAVGFAGLLQLLQIALVLGIFGSTSLYITGSSADVWVGYP
GTQSVSLGRTIDADVESRLLMDPAVQQVEPYLWVDGDWRGPRETGGVSVFVSGIDPAADA
LMFSKVLAPALRRRLAEPDAIVIDRSAMDQLGVGIGQTATINGHQVRVVGISRGLRALGG
VNVLCSLDTARRLDNDPADLGPTYLVAKLRDPTQADAVAMRLRGDTAFGPYTAWSAADFA
NISVRYWLFDTGAGAGVLFLAGIVFLVGAAITSQTLIAAVNGSVREYATLNALGVGVGAL
RKVVLEQAFWVGALGLLGASALGILLMLLARSQDVPVVLNVPAALACILLVMGLAAVSGL
AAMRSLRRADPATLLR