Protein Info for LRK53_RS06925 in Rhodanobacter sp000427505 FW510-R12

Annotation: MtnX-like HAD-IB family phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 233 TIGR01489: 2,3-diketo-5-methylthio-1-phosphopentane phosphatase" amino acids 8 to 185 (178 residues), 92.5 bits, see alignment E=3.5e-30 PF12710: HAD" amino acids 8 to 176 (169 residues), 43 bits, see alignment E=6.9e-15 PF06888: Put_Phosphatase" amino acids 8 to 182 (175 residues), 27.9 bits, see alignment E=1.6e-10 TIGR01488: HAD phosphoserine phosphatase-like hydrolase, family IB" amino acids 8 to 178 (171 residues), 69.7 bits, see alignment E=3.1e-23

Best Hits

KEGG orthology group: None (inferred from 60% identity to smt:Smal_1184)

Predicted SEED Role

"2-hydroxy-3-keto-5-methylthiopentenyl-1-phosphate phosphatase related protein" in subsystem Methionine Salvage

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (233 amino acids)

>LRK53_RS06925 MtnX-like HAD-IB family phosphatase (Rhodanobacter sp000427505 FW510-R12)
MPVSSWTILCDFDGTISVEDVIDSLLDRFGRPGWEVLEQDWRAGRIGSRECMAGQVDLLQ
MSRAELDEHLREMWIDHAFPGFVAKARELGVPVRVVSDGLDYAIHRILARYGLDDLPLAA
NHLAPATPPKQWQLTSPFQADGCRSGTCKCACVAKARSSGAKTLLIGDGASDFCAADRVD
FVFAKHRLIEHCRAAGIPYMPITGFEDALELLPQLLDGSLFDRPAVPASAVLA