Protein Info for LRK53_RS06900 in Rhodanobacter sp000427505 FW510-R12

Annotation: 2-dehydropantoate 2-reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 TIGR00745: 2-dehydropantoate 2-reductase" amino acids 2 to 303 (302 residues), 198.5 bits, see alignment E=7.8e-63 PF02558: ApbA" amino acids 3 to 152 (150 residues), 137.8 bits, see alignment E=2.4e-44 PF08546: ApbA_C" amino acids 179 to 302 (124 residues), 76.6 bits, see alignment E=2.2e-25

Best Hits

KEGG orthology group: K00077, 2-dehydropantoate 2-reductase [EC: 1.1.1.169] (inferred from 57% identity to rpc:RPC_0016)

Predicted SEED Role

"2-dehydropantoate 2-reductase (EC 1.1.1.169)" in subsystem Coenzyme A Biosynthesis (EC 1.1.1.169)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.169

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (306 amino acids)

>LRK53_RS06900 2-dehydropantoate 2-reductase (Rhodanobacter sp000427505 FW510-R12)
MRILIVGAGATGGYFGGRLLEHGRDVTFLVHEKRAAQLARHGLSIKSATGDTALPSPPTV
LASGLREPYELILLSCKAYGLEQAMADIAPAVGPDTTILPLLNGMRQLDLLDARFGAQHV
LGGQCVIAATLDEDGSVRHLNTSHSLTFGERDGSASARMQRITQALSDAGFDARPSSTVL
QDMWDKWIFLATLAGITCLMRGSVGEIVAAPGGTAAALDLLEDCCAVAGRAGHAPSEQTL
QRARHVLTEAGSTLTASMLRDLRHGHPIEADHIVGDLLARADRSRDERSLLATVYAHLKV
YEAGRA