Protein Info for LRK53_RS06835 in Rhodanobacter sp000427505 FW510-R12

Annotation: tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 348 TIGR00113: S-adenosylmethionine:tRNA ribosyltransferase-isomerase" amino acids 1 to 339 (339 residues), 429.2 bits, see alignment E=5.2e-133 PF02547: Queuosine_synth" amino acids 4 to 338 (335 residues), 438.8 bits, see alignment E=5.8e-136

Best Hits

Swiss-Prot: 67% identical to QUEA_STRM5: S-adenosylmethionine:tRNA ribosyltransferase-isomerase (queA) from Stenotrophomonas maltophilia (strain R551-3)

KEGG orthology group: K07568, S-adenosylmethionine:tRNA ribosyltransferase-isomerase [EC: 5.-.-.-] (inferred from 67% identity to sml:Smlt2008)

MetaCyc: 52% identical to tRNA preQ134 S-adenosylmethionine ribosyltransferase-isomerase (Escherichia coli K-12 substr. MG1655)
RXN0-1342 [EC: 2.4.99.17]

Predicted SEED Role

"S-adenosylmethionine:tRNA ribosyltransferase-isomerase (EC 5.-.-.-)" in subsystem Queuosine-Archaeosine Biosynthesis (EC 5.-.-.-)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.99.17 or 5.-.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (348 amino acids)

>LRK53_RS06835 tRNA preQ1(34) S-adenosylmethionine ribosyltransferase-isomerase QueA (Rhodanobacter sp000427505 FW510-R12)
MKKSDFDFELPPGLIAQAPLPERSASRMLLLDVPAQSQQDRMFRELPDLLRPGDLLVFND
TRVLPARLYGRKDTGGAVEILIERVTGAHEAVVQLGVSKKPKEGARIELADGSRALVLGR
DESFFRLRFEAPEPLEELLQKLGEMPLPPYIERHADASDMERYQTVFAREPGAVAAPTAG
LHFDQPMLGRLRERGVDFGYITLHVGAGTFQPVRVDDIKDHRMHREWLNVGAHLIGQIRR
ARANGGRVIAVGTTVVRALESASRDGELHPFAGETQIFIFPGYRFSSIDGLITNFHLPQS
TLLMLVSALAGREFMLGAYRHAVEQRYRFFSYGDAMLILPHGVGQDKG