Protein Info for LRK53_RS06270 in Rhodanobacter sp000427505 FW510-R12

Annotation: SpoIIE family protein phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 700 762 signal peptide" amino acids 1 to 27 (27 residues), see Phobius details transmembrane" amino acids 282 to 304 (23 residues), see Phobius details PF22673: MCP-like_PDC_1" amino acids 73 to 186 (114 residues), 42.2 bits, see alignment E=2.5e-14 PF00672: HAMP" amino acids 304 to 354 (51 residues), 48.5 bits, see alignment 2.2e-16 PF07228: SpoIIE" amino acids 423 to 613 (191 residues), 152.3 bits, see alignment E=4e-48 PF13581: HATPase_c_2" amino acids 636 to 751 (116 residues), 76.6 bits, see alignment E=4.5e-25

Best Hits

Predicted SEED Role

"Serine phosphatase RsbU, regulator of sigma subunit" in subsystem SigmaB stress responce regulation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (762 amino acids)

>LRK53_RS06270 SpoIIE family protein phosphatase (Rhodanobacter sp000427505 FW510-R12)
MALWVLVGSAVVLAATGALLLGLTRAQILEHTHREAASLAADAGNQIQARIDRVAVSARM
LAAIIGSRRDDAEPLLRDTLAADLDMDGLAAAFRPSADPAAPPPYSPFVRRLDHGSLADR
DLSRDANPYWNSNWFLGGLGCSNGCWQRPFFSQSRRRQLINYSVAIRRDGHPVGVINADV
TLDWLHRILGGLAKPAGAYAFVLDSDGNFLAHDNPTMVGQRGMPALLGVLASDRAESTRL
PKAQNPRANGPVWVYSAPIEGTRWRFGLVIPEQHIYAGVRHIFLLSLALGLLALLGVALI
TLLTIRRTMAPLKVLVDRVEHVARGELDFELPPARRPDEVGRLTQSFDQMRRELALHLED
LARVAREKQRLASELEIAHQIQLGLLPSKHYLDAVCAQFELHAALRPARAVGGDLYSYFM
LDPQRFFVMVGDVSDKGIPAALFMAQTITLAKVLAPRAQTPRSLLQLLNLELCRGNDSCM
FATLLCGLLDTGSGSLLLASAGHEPPILCGRGAPQLLEFPTGAVLGLYEDSDYHEHRLRL
HQGETLLMYTDGITEASNREQRMYGIERTVESLAMVPPAAPTADYIERLLGDVDRFVADA
AQTDDITVLALTWHGATPPAARISIGTQLVDVFGALDRCENLLEDAEVPASLRSDMRLVL
EELMVNTVEYGYPDGRPGQIRLLLQPQPEAVVVELIDDGIAFDPLQSAAPDLTGDLADRE
QLGGLGIHLARTMASEMRYTRDADGNHLLLRFAYPNLDESSS