Protein Info for LRK53_RS06175 in Rhodanobacter sp000427505 FW510-R12

Annotation: acylphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00708: Acylphosphatase
  • amino acids 5 to 86 (82 residues), 79.8 bits, E=7.4e-27

Best Hits

Swiss-Prot: 60% identical to ACYP_XANOM: Acylphosphatase (acyP) from Xanthomonas oryzae pv. oryzae (strain MAFF 311018)

KEGG orthology group: K01512, acylphosphatase [EC: 3.6.1.7] (inferred from 60% identity to tgr:Tgr7_2243)

Predicted SEED Role

"Acylphosphate phosphohydrolase (EC 3.6.1.7), putative" in subsystem Pyruvate metabolism II: acetyl-CoA, acetogenesis from pyruvate (EC 3.6.1.7)

KEGG Metabolic Maps

• Benzoate degradation via CoA ligation
• Pyruvate metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.7

Protein Sequence (88 amino acids)

>LRK53_RS06175 acylphosphatase (Rhodanobacter sp000427505 FW510-R12)
MPTARFIVSGRVQGVFYRASTHGQALALGVAGHARNRPDGSVEVLACGTAEALDALERWL
HQGPSAARVETVSREDLPEQDLHGFHTG