Protein Info for LRK53_RS06165 in Rhodanobacter sp000427505 FW510-R12

Annotation: YihY family inner membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 425 transmembrane" amino acids 33 to 57 (25 residues), see Phobius details amino acids 95 to 114 (20 residues), see Phobius details amino acids 135 to 159 (25 residues), see Phobius details amino acids 175 to 196 (22 residues), see Phobius details amino acids 208 to 226 (19 residues), see Phobius details amino acids 240 to 270 (31 residues), see Phobius details TIGR00765: YihY family inner membrane protein" amino acids 15 to 271 (257 residues), 231 bits, see alignment E=1.1e-72 PF03631: Virul_fac_BrkB" amino acids 23 to 270 (248 residues), 186.2 bits, see alignment E=4.7e-59

Best Hits

Predicted SEED Role

"Ribonuclease BN (EC 3.1.-.-)" in subsystem LMPTP YfkJ cluster or tRNA processing (EC 3.1.-.-)

Isozymes

Compare fitness of predicted isozymes for: 3.1.-.-

Use Curated BLAST to search for 3.1.-.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (425 amino acids)

>LRK53_RS06165 YihY family inner membrane protein (Rhodanobacter sp000427505 FW510-R12)
MIRRFNRDRTKSLGRFLWRRFVDDKCFETAGALSYTTLVSLVPLTVAVLAMFSAFPVFQP
ARDTLIDFVFSNFVPSTGEAVQATMLGFAANASKLTGISILVMLFSALSMMISIEDRLNR
IWRVQQARSWSSRLLLYWAALTLGPILVVGGIAVTSYLIAAPLLHSAADQLGGVAQGLLS
TLPFVVTFFTLWLMYSVIPNCKVSRRDAAIGALLGAVLFEIARWGFGQFVQQAQTYQQIY
GVLAAIPIFLLWIYLSWVIVILAASVAAAASAFEYHAPMQTLPEGAEFLGLLVVLRHLVE
AQRRGGCVDPAELRASEPYLRSALIADYFDDLQRAELIRRGETGGWLLCRSLDSTDLLRV
YRHTDYRLPLQPQNEAAALGIALPPELLAMLTELAAVLRAKLGARLDEIYPPAADPAADP
EELPA