Protein Info for LRK53_RS06055 in Rhodanobacter sp000427505 FW510-R12

Annotation: type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 204 PF13338: AbiEi_4" amino acids 11 to 57 (47 residues), 52 bits, see alignment 3e-18

Best Hits

KEGG orthology group: None (inferred from 76% identity to vap:Vapar_5648)

Predicted SEED Role

"FIG01210155: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (204 amino acids)

>LRK53_RS06055 type IV toxin-antitoxin system AbiEi family antitoxin domain-containing protein (Rhodanobacter sp000427505 FW510-R12)
MTKPPLNHEKQILALARKQPLLRARDLAAHGLPTMTLSRLVAAGKLQRVARGVYSLPQRA
ISAHRSLAEVAIRVPRGVVCLLSALRLHGIGTQAPFEVWLAIPQTMPTPRLKQPALRVVR
MSGSALSEGIEQVDVDGVAVSVFNLGKTVADCFKYRNKIGLDVALEALGEAWRARRVTMD
ELWHYATIDRVHNVMRPYLEALDA