Protein Info for LRK53_RS05995 in Rhodanobacter sp000427505 FW510-R12

Annotation: oligosaccharide flippase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 416 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 42 to 66 (25 residues), see Phobius details amino acids 81 to 104 (24 residues), see Phobius details amino acids 112 to 135 (24 residues), see Phobius details amino acids 147 to 166 (20 residues), see Phobius details amino acids 173 to 193 (21 residues), see Phobius details amino acids 246 to 267 (22 residues), see Phobius details amino acids 287 to 314 (28 residues), see Phobius details amino acids 327 to 350 (24 residues), see Phobius details amino acids 357 to 376 (20 residues), see Phobius details amino acids 382 to 402 (21 residues), see Phobius details PF01943: Polysacc_synt" amino acids 9 to 274 (266 residues), 54.7 bits, see alignment E=1.1e-18 PF13440: Polysacc_synt_3" amino acids 29 to 269 (241 residues), 34 bits, see alignment E=1.9e-12

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (416 amino acids)

>LRK53_RS05995 oligosaccharide flippase family protein (Rhodanobacter sp000427505 FW510-R12)
MKGPLARSSLQTSVMLGLRVMTQAVVLVLLTRLLGPRAYGSFAAAASLAVVLGLLPNFGA
GFVMLARNAHDANGTAAVWRYAWPMTVLFGLLLLAFYIVVASFVTRPALPLHVLLAMGAA
ELLLTPFTMLLSFALQARERVPLSQCVQWLPLGLRVLAVLPCFLLPDGQRLSAYVFFQLL
ASLLGLLLGLWITSRLVTLDWRPRRATREELSDGASYAAMNLVAANPSELDKIIAVRLVG
AHDAGIYAATARVMAATVMPVTAMLLASLPRLFRHAHTPTREGQRLIGLIALLALAWGLA
SGLLLALCSPLLPWLFGTSFVAMAQLMPWLAAVAPLLSLRLAAGAVLVALGKPLERMAFE
LSGILLLVGSMLALAPHYGIRGLAVALVIAETSMALIGWWLVHRRLANHVAMGGIF