Protein Info for LRK53_RS05935 in Rhodanobacter sp000427505 FW510-R12

Annotation: type II secretion system F family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 189 to 214 (26 residues), see Phobius details amino acids 241 to 260 (20 residues), see Phobius details amino acids 396 to 417 (22 residues), see Phobius details PF28597: T2SSF_N" amino acids 27 to 67 (41 residues), 39.2 bits, see alignment 4.8e-14 PF00482: T2SSF" amino acids 89 to 212 (124 residues), 119.2 bits, see alignment E=1.1e-38 amino acids 293 to 415 (123 residues), 106.9 bits, see alignment E=7.5e-35

Best Hits

Swiss-Prot: 54% identical to PILC_PSEAE: Type 4 fimbrial assembly protein PilC (pilC) from Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)

KEGG orthology group: K02653, type IV pilus assembly protein PilC (inferred from 60% identity to psu:Psesu_0653)

Predicted SEED Role

"Type IV fimbrial assembly protein PilC" in subsystem Type IV pilus

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>LRK53_RS05935 type II secretion system F family protein (Rhodanobacter sp000427505 FW510-R12)
MATATATNINKARELGAQRAEVSKLTTYEWVALDKRGKRMKGDMPAKNATLVKAELRRQG
MNPQTVRERAKPLFGSTGSTIKPGDVAIFSRQIATMMASGVPMIQAFDIIADGQKNIRFK
NVLIDVKQNIEGGSSLHEALGRYPVQFDELYCNLVKAGEASGVLDTVLDTVATYKERTEA
IKKKIKKALFYPMMVLAVVFIVVLIMLLFVVPVFAKTFQDAGAQLPAPTQLLVTASEFMQ
SYWFIVVGLIGGGIAAIVIAKKRSVKFAHFLDRMSLKMPVMGSIVRNSAIARFARTLGVT
FRAGVPLVEAMDAVAGATGSVVYGDAVKQMRDDISVGHQLQLAMKQTGLFPNMVVQMTAI
GEESGALDNMLFKVAEFYEEEVSNAVDTLSTLLEPIIMVVLGTLVGGMVVALYLPIFKLA
GTF