Protein Info for LRK53_RS05765 in Rhodanobacter sp000427505 FW510-R12

Annotation: 16S rRNA (uracil(1498)-N(3))-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00046: RNA methyltransferase, RsmE family
  • amino acids 18 to 241 (224 residues), 191.8 bits, E=6e-61
• PF20260: PUA_4
  • amino acids 21 to 67 (47 residues), 44.2 bits, 1.7e-15
• PF04452: Methyltrans_RNA
  • amino acids 75 to 238 (164 residues), 165 bits, E=1.2e-52

Best Hits

Swiss-Prot: 43% identical to RSME_DICD3: Ribosomal RNA small subunit methyltransferase E (rsmE) from Dickeya dadantii (strain 3937)

KEGG orthology group: K09761, ribosomal RNA small subunit methyltransferase E [EC: 2.1.1.-] (inferred from 56% identity to xal:XALc_2213)

MetaCyc: 41% identical to 16S rRNA m3U1498 methyltransferase (Escherichia coli K-12 substr. MG1655)
RXN-11598 [EC: 2.1.1.193]

Predicted SEED Role

"Ribosomal RNA small subunit methyltransferase E (EC 2.1.1.-)" in subsystem Heat shock dnaK gene cluster extended (EC 2.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 2.1.1.193

Protein Sequence (244 amino acids)

>LRK53_RS05765 16S rRNA (uracil(1498)-N(3))-methyltransferase (Rhodanobacter sp000427505 FW510-R12)
MRTIRIHLDQPLAVAAELNLPAQAAEHVARVLRMNPGDPLTVFNGDGHDYAAIILAMGKR
ELSVRIESKQLVRNESPLPLTLAQGVARGEKMDLIVQKATELGVARIVPLLTERSEVKLD
ATRAERRLAHWRAVVASACEQSGRARLPEVAPALPLAAWLHDLADDGALRLALLPEAGRA
SRELRFTAAGGLLVVGPEGGLGERDVGALGAAGFEGLQLGPRVLRTETAGLAALAALQAL
HGDG